BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0411 (422 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M64231-1|AAA60574.1| 302|Homo sapiens spermidine synthase protein. 40 0.005 M34338-1|AAA36633.1| 302|Homo sapiens spermidine synthase protein. 40 0.005 BC033106-1|AAH33106.1| 302|Homo sapiens spermidine synthase pro... 40 0.005 BC000309-1|AAH00309.1| 302|Homo sapiens spermidine synthase pro... 40 0.005 AL109811-6|CAI22104.1| 302|Homo sapiens spermidine synthase pro... 40 0.005 AB209417-1|BAD92654.1| 503|Homo sapiens zinc finger protein 519... 33 0.52 BC024227-1|AAH24227.1| 540|Homo sapiens zinc finger protein 519... 32 0.69 >M64231-1|AAA60574.1| 302|Homo sapiens spermidine synthase protein. Length = 302 Score = 39.5 bits (88), Expect = 0.005 Identities = 12/31 (38%), Positives = 21/31 (67%) Frame = +2 Query: 329 LKTNWFTESCDMWPGGTFSFEVKEVLHTEKS 421 ++ WF E+C +WPG S +V+++LH +S Sbjct: 16 IREGWFRETCSLWPGQALSLQVEQLLHHRRS 46 >M34338-1|AAA36633.1| 302|Homo sapiens spermidine synthase protein. Length = 302 Score = 39.5 bits (88), Expect = 0.005 Identities = 12/31 (38%), Positives = 21/31 (67%) Frame = +2 Query: 329 LKTNWFTESCDMWPGGTFSFEVKEVLHTEKS 421 ++ WF E+C +WPG S +V+++LH +S Sbjct: 16 IREGWFRETCSLWPGQALSLQVEQLLHHRRS 46 >BC033106-1|AAH33106.1| 302|Homo sapiens spermidine synthase protein. Length = 302 Score = 39.5 bits (88), Expect = 0.005 Identities = 12/31 (38%), Positives = 21/31 (67%) Frame = +2 Query: 329 LKTNWFTESCDMWPGGTFSFEVKEVLHTEKS 421 ++ WF E+C +WPG S +V+++LH +S Sbjct: 16 IREGWFRETCSLWPGQALSLQVEQLLHHRRS 46 >BC000309-1|AAH00309.1| 302|Homo sapiens spermidine synthase protein. Length = 302 Score = 39.5 bits (88), Expect = 0.005 Identities = 12/31 (38%), Positives = 21/31 (67%) Frame = +2 Query: 329 LKTNWFTESCDMWPGGTFSFEVKEVLHTEKS 421 ++ WF E+C +WPG S +V+++LH +S Sbjct: 16 IREGWFRETCSLWPGQALSLQVEQLLHHRRS 46 >AL109811-6|CAI22104.1| 302|Homo sapiens spermidine synthase protein. Length = 302 Score = 39.5 bits (88), Expect = 0.005 Identities = 12/31 (38%), Positives = 21/31 (67%) Frame = +2 Query: 329 LKTNWFTESCDMWPGGTFSFEVKEVLHTEKS 421 ++ WF E+C +WPG S +V+++LH +S Sbjct: 16 IREGWFRETCSLWPGQALSLQVEQLLHHRRS 46 >AB209417-1|BAD92654.1| 503|Homo sapiens zinc finger protein 519 variant protein. Length = 503 Score = 32.7 bits (71), Expect = 0.52 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = -3 Query: 216 CIPCSKYKNSFRPSYELNITELTFHNHDIYVQRYDSIH 103 CIP +KY++ F S N ++ F NHD + ++ S H Sbjct: 102 CIPMNKYQHKFLKSVFCNKNQINF-NHDSNISKHHSTH 138 >BC024227-1|AAH24227.1| 540|Homo sapiens zinc finger protein 519 protein. Length = 540 Score = 32.3 bits (70), Expect = 0.69 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = -3 Query: 216 CIPCSKYKNSFRPSYELNITELTFHNHDIYVQRYDSIH 103 CIP +KY++ F S N ++ F NHD + ++ S H Sbjct: 139 CIPMNKYQHKFLKSVFCNKNQINF-NHDSDISKHHSTH 175 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 56,245,592 Number of Sequences: 237096 Number of extensions: 979519 Number of successful extensions: 1792 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1726 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1792 length of database: 76,859,062 effective HSP length: 83 effective length of database: 57,180,094 effective search space used: 3259265358 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -