BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0409 (715 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0409 - 3084821-3084988,3085069-3085155,3085270-3085476,308... 33 0.30 01_06_0986 - 33602714-33602741,33603037-33603146,33603401-336036... 29 3.7 08_02_0823 + 21557111-21557292,21557391-21557473,21557722-215578... 28 8.5 07_01_0733 + 5570084-5570282,5570395-5570600,5572484-5572624,557... 28 8.5 06_01_0581 - 4153668-4153883,4154070-4155104,4155718-4156292,415... 28 8.5 >01_01_0409 - 3084821-3084988,3085069-3085155,3085270-3085476, 3085904-3085985,3086085-3086275,3086410-3086616, 3086709-3086871,3087905-3087960,3088035-3088148, 3088599-3089807 Length = 827 Score = 32.7 bits (71), Expect = 0.30 Identities = 15/55 (27%), Positives = 25/55 (45%) Frame = -2 Query: 354 SHPCKEIYEPCCQIYVPVPQFVCPIIPRKNVMVIVKSFTKSKCICHATLSSFQAL 190 + PC+E PC ++ P CP+ N K+ K C C A + +F+ + Sbjct: 571 AEPCEECNLPCQRVREPPCSHPCPLPCHLNDCPPCKALVKRPCHCGAMVHAFECM 625 >01_06_0986 - 33602714-33602741,33603037-33603146,33603401-33603601, 33604605-33604697,33604937-33605182,33606007-33606372, 33606459-33606599,33607170-33607526 Length = 513 Score = 29.1 bits (62), Expect = 3.7 Identities = 15/48 (31%), Positives = 22/48 (45%) Frame = +3 Query: 207 SKWHGKCIYFW*RISQLPSRFSVGLSGRRIGGQVHKFDNKVHRFLCMD 350 ++W G C Y ++ F G G GG +H NK H + C+D Sbjct: 87 AEWKGACFYD----NRAWMEFHNGTDGGLGGGTLHLETNKAHSWTCID 130 >08_02_0823 + 21557111-21557292,21557391-21557473,21557722-21557810, 21557985-21558058,21558264-21558314,21558406-21558482, 21560206-21560900 Length = 416 Score = 27.9 bits (59), Expect = 8.5 Identities = 24/91 (26%), Positives = 37/91 (40%), Gaps = 1/91 (1%) Frame = +1 Query: 55 LAPMYFWGESLNNAWHITVLRYIFSLNGTFLVNSAAHLWGYKPYDKSLKATQSGMANAFT 234 LA + +WG H TVL + S L + Y SL+ SG + + Sbjct: 103 LAALKYWG-------HDTVLNFPLSTYDEELKEMEGQ--SREEYIGSLRRKSSGFSRGVS 153 Query: 235 FGEGFHNYHHVFPWDYRADEL-GDRYINLTT 324 G +HH W+ R + G++Y+ L T Sbjct: 154 KYRGVARHHHNGKWEARIGRVFGNKYLYLGT 184 >07_01_0733 + 5570084-5570282,5570395-5570600,5572484-5572624, 5572773-5572949,5573049-5573145,5573575-5573687, 5573774-5573896,5574004-5574075,5575340-5575432, 5575564-5575674,5575767-5575889,5576834-5576890, 5576939-5577022,5577140-5577214,5577418-5577554, 5577719-5577853,5579029-5579168,5579334-5579399, 5579732-5579838,5579910-5579990,5580064-5580138, 5580224-5580325,5581837-5582005,5582090-5582217, 5582596-5582679,5582779-5582879,5583729-5583882, 5583964-5584038,5584112-5584262,5584463-5585078, 5585427-5585487,5585874-5586019,5586104-5586287, 5586363-5586440,5586603-5586931,5587023-5587199, 5587571-5587667,5587742-5587897,5587962-5588198, 5588271-5588354,5588426-5588486,5588762-5588898 Length = 1912 Score = 27.9 bits (59), Expect = 8.5 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +1 Query: 148 VNSAAHLWGYKPYDKSLKATQSGMANAFTFGEGFHNY 258 V HL G+ P DK++ + ++NAF G+ ++ Sbjct: 765 VRFLGHLTGFSPKDKAVDRSVEKLSNAFYVGQSVRSH 801 >06_01_0581 - 4153668-4153883,4154070-4155104,4155718-4156292, 4158457-4158826,4159925-4160590,4161008-4161223, 4161725-4161793 Length = 1048 Score = 27.9 bits (59), Expect = 8.5 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 192 EPESYSKWHGKCIYFW 239 E E SKW +C YFW Sbjct: 3 EVEEVSKWRRRCCYFW 18 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,161,929 Number of Sequences: 37544 Number of extensions: 351181 Number of successful extensions: 758 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 744 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 757 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1851002996 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -