BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0404 (575 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 prot... 22 4.3 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 21 7.5 AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 21 9.9 >AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 protein. Length = 377 Score = 21.8 bits (44), Expect = 4.3 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +1 Query: 79 DLNLCSKVNFITDNGRDDG 135 D NLC+ VN+ DDG Sbjct: 46 DANLCTHVNYAFLGLNDDG 64 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 21.0 bits (42), Expect = 7.5 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 170 IVHMVAVIPFYFPSSRPLS 114 ++ ++ I F FP S PLS Sbjct: 524 VISLIDEISFTFPPSPPLS 542 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 20.6 bits (41), Expect = 9.9 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = -1 Query: 473 YTISCNTERNTRNSIQLKYRELPI*CVFCYL 381 YTI+ N + + RN + + + C F YL Sbjct: 123 YTINYNFKESERNDYVSLLQLVFVFCYFIYL 153 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 133,819 Number of Sequences: 336 Number of extensions: 2699 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14308417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -