BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0403 (670 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q4N4G1 Cluster: Putative uncharacterized protein; n=1; ... 33 8.2 >UniRef50_Q4N4G1 Cluster: Putative uncharacterized protein; n=1; Theileria parva|Rep: Putative uncharacterized protein - Theileria parva Length = 123 Score = 32.7 bits (71), Expect = 8.2 Identities = 18/44 (40%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +3 Query: 246 ITKL-AKFSLVYLKQILYDWFQLVGVKCTFTG--SLGNLSVPSL 368 IT++ FS K +++D L+G KC FTG ++ NLS+PS+ Sbjct: 47 ITRVFGNFSFSAFKSVVFDVNVLLGKKCPFTGLRTMPNLSLPSV 90 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 528,607,373 Number of Sequences: 1657284 Number of extensions: 8996389 Number of successful extensions: 14436 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 14005 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14431 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 51239674196 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -