BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0403 (670 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0480 + 17958726-17958926,17959294-17959382,17960176-179602... 28 7.7 >09_04_0480 + 17958726-17958926,17959294-17959382,17960176-17960242, 17960329-17960444,17960978-17961044,17961158-17961206, 17961630-17961715,17961825-17962078,17962158-17962213, 17962683-17962768,17963047-17963139,17963790-17964219, 17964338-17964861,17964962-17965190,17965271-17965566 Length = 880 Score = 27.9 bits (59), Expect = 7.7 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = -2 Query: 372 TIKMEHLNCPNYL*KYTSLQPIETNHIRFVLNKLMKILP 256 T K+E PN K ++ I T H F L++ M+I+P Sbjct: 473 TSKLESNEVPNDSDKKSNSTSIRTEHSNFPLHRCMRIVP 511 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,934,343 Number of Sequences: 37544 Number of extensions: 201441 Number of successful extensions: 256 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 252 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 256 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1691314196 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -