BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0402 (683 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC110537-1|AAI10538.1| 819|Homo sapiens IWS1 homolog (S. cerevi... 36 0.10 BC110536-1|AAI10537.1| 819|Homo sapiens IWS1 homolog (S. cerevi... 36 0.10 BC065279-1|AAH65279.1| 375|Homo sapiens IWS1 protein protein. 36 0.10 AK027561-1|BAB55198.1| 819|Homo sapiens protein ( Homo sapiens ... 36 0.10 X64037-1|CAA45408.1| 517|Homo sapiens RNA polymerase II associa... 35 0.23 X64002-1|CAA45404.1| 517|Homo sapiens RAP74 protein. 35 0.23 CR456798-1|CAG33079.1| 517|Homo sapiens GTF2F1 protein. 35 0.23 BT007097-1|AAP35761.1| 517|Homo sapiens general transcription f... 35 0.23 BC013007-1|AAH13007.1| 517|Homo sapiens general transcription f... 35 0.23 BC000120-1|AAH00120.1| 517|Homo sapiens general transcription f... 35 0.23 X15949-1|CAA34073.1| 349|Homo sapiens protein ( Human mRNA for ... 33 0.72 CR457077-1|CAG33358.1| 349|Homo sapiens IRF2 protein. 33 0.72 BT007264-1|AAP35928.1| 349|Homo sapiens interferon regulatory f... 33 0.72 BC015803-1|AAH15803.1| 349|Homo sapiens interferon regulatory f... 33 0.72 U94319-1|AAB52589.1| 351|Homo sapiens DFS70 protein. 30 6.7 AJ640137-1|CAG26691.1| 2697|Homo sapiens delangin protein. 30 8.8 AJ627032-1|CAF25290.1| 2804|Homo sapiens delangin protein. 30 8.8 AB019602-1|BAA77349.1| 2158|Homo sapiens IDN3-B protein. 30 8.8 AB019494-1|BAA77335.1| 2265|Homo sapiens IDN3 protein. 30 8.8 >BC110537-1|AAI10538.1| 819|Homo sapiens IWS1 homolog (S. cerevisiae) protein. Length = 819 Score = 36.3 bits (80), Expect = 0.10 Identities = 26/82 (31%), Positives = 44/82 (53%), Gaps = 4/82 (4%) Frame = +1 Query: 448 PKPDCQIDIQEESNQSDSNKEDSQEQALDIKPSMEP--EKATNQVSLESDNYSISDVNS- 618 P D +I+ ++S SDS ED+ + + S EP +A++ + E +SD S Sbjct: 155 PASDSEIEELQKSPASDSETEDALKPQISDSESEEPPRHQASDSENEEPPKPRMSDSESE 214 Query: 619 ELPQPKVLNA-NEEPEIEKKDD 681 ELP+P+V ++ +EEP + D Sbjct: 215 ELPKPQVSDSESEEPPRHQASD 236 >BC110536-1|AAI10537.1| 819|Homo sapiens IWS1 homolog (S. cerevisiae) protein. Length = 819 Score = 36.3 bits (80), Expect = 0.10 Identities = 26/82 (31%), Positives = 44/82 (53%), Gaps = 4/82 (4%) Frame = +1 Query: 448 PKPDCQIDIQEESNQSDSNKEDSQEQALDIKPSMEP--EKATNQVSLESDNYSISDVNS- 618 P D +I+ ++S SDS ED+ + + S EP +A++ + E +SD S Sbjct: 155 PASDSEIEELQKSPASDSETEDALKPQISDSESEEPPRHQASDSENEEPPKPRMSDSESE 214 Query: 619 ELPQPKVLNA-NEEPEIEKKDD 681 ELP+P+V ++ +EEP + D Sbjct: 215 ELPKPQVSDSESEEPPRHQASD 236 >BC065279-1|AAH65279.1| 375|Homo sapiens IWS1 protein protein. Length = 375 Score = 36.3 bits (80), Expect = 0.10 Identities = 26/82 (31%), Positives = 44/82 (53%), Gaps = 4/82 (4%) Frame = +1 Query: 448 PKPDCQIDIQEESNQSDSNKEDSQEQALDIKPSMEP--EKATNQVSLESDNYSISDVNS- 618 P D +I+ ++S SDS ED+ + + S EP +A++ + E +SD S Sbjct: 155 PASDSEIEELQKSPASDSETEDALKPQISDSESEEPPRHQASDSENEEPPKPRMSDSESE 214 Query: 619 ELPQPKVLNA-NEEPEIEKKDD 681 ELP+P+V ++ +EEP + D Sbjct: 215 ELPKPQVSDSESEEPPRHQASD 236 >AK027561-1|BAB55198.1| 819|Homo sapiens protein ( Homo sapiens cDNA FLJ14655 fis, clone NT2RP2002292. ). Length = 819 Score = 36.3 bits (80), Expect = 0.10 Identities = 26/82 (31%), Positives = 44/82 (53%), Gaps = 4/82 (4%) Frame = +1 Query: 448 PKPDCQIDIQEESNQSDSNKEDSQEQALDIKPSMEP--EKATNQVSLESDNYSISDVNS- 618 P D +I+ ++S SDS ED+ + + S EP +A++ + E +SD S Sbjct: 155 PASDSEIEELQKSPASDSETEDALKPQISDSESEEPPRHQASDSENEEPPKPRMSDSESE 214 Query: 619 ELPQPKVLNA-NEEPEIEKKDD 681 ELP+P+V ++ +EEP + D Sbjct: 215 ELPKPQVSDSESEEPPRHQASD 236 >X64037-1|CAA45408.1| 517|Homo sapiens RNA polymerase II associated protein RAP74 protein. Length = 517 Score = 35.1 bits (77), Expect = 0.23 Identities = 19/55 (34%), Positives = 29/55 (52%) Frame = +1 Query: 457 DCQIDIQEESNQSDSNKEDSQEQALDIKPSMEPEKATNQVSLESDNYSISDVNSE 621 D Q D EES + +ED +E+ P+ + +K S ESD+ SD++SE Sbjct: 302 DEQSDSSEESEEEKPPEEDKEEEEEKKAPTPQEKKRRKDSSEESDSSEESDIDSE 356 >X64002-1|CAA45404.1| 517|Homo sapiens RAP74 protein. Length = 517 Score = 35.1 bits (77), Expect = 0.23 Identities = 19/55 (34%), Positives = 29/55 (52%) Frame = +1 Query: 457 DCQIDIQEESNQSDSNKEDSQEQALDIKPSMEPEKATNQVSLESDNYSISDVNSE 621 D Q D EES + +ED +E+ P+ + +K S ESD+ SD++SE Sbjct: 302 DEQSDSSEESEEEKPPEEDKEEEEEKKAPTPQEKKRRKDSSEESDSSEESDIDSE 356 >CR456798-1|CAG33079.1| 517|Homo sapiens GTF2F1 protein. Length = 517 Score = 35.1 bits (77), Expect = 0.23 Identities = 19/55 (34%), Positives = 29/55 (52%) Frame = +1 Query: 457 DCQIDIQEESNQSDSNKEDSQEQALDIKPSMEPEKATNQVSLESDNYSISDVNSE 621 D Q D EES + +ED +E+ P+ + +K S ESD+ SD++SE Sbjct: 302 DEQSDSSEESEEEKPPEEDKEEEEEKKAPTPQEKKRRKDSSEESDSSEESDIDSE 356 >BT007097-1|AAP35761.1| 517|Homo sapiens general transcription factor IIF, polypeptide 1, 74kDa protein. Length = 517 Score = 35.1 bits (77), Expect = 0.23 Identities = 19/55 (34%), Positives = 29/55 (52%) Frame = +1 Query: 457 DCQIDIQEESNQSDSNKEDSQEQALDIKPSMEPEKATNQVSLESDNYSISDVNSE 621 D Q D EES + +ED +E+ P+ + +K S ESD+ SD++SE Sbjct: 302 DEQSDSSEESEEEKPPEEDKEEEEEKKAPTPQEKKRRKDSSEESDSSEESDIDSE 356 >BC013007-1|AAH13007.1| 517|Homo sapiens general transcription factor IIF, polypeptide 1, 74kDa protein. Length = 517 Score = 35.1 bits (77), Expect = 0.23 Identities = 19/55 (34%), Positives = 29/55 (52%) Frame = +1 Query: 457 DCQIDIQEESNQSDSNKEDSQEQALDIKPSMEPEKATNQVSLESDNYSISDVNSE 621 D Q D EES + +ED +E+ P+ + +K S ESD+ SD++SE Sbjct: 302 DEQSDSSEESEEEKPPEEDKEEEEEKKAPTPQEKKRRKDSSEESDSSEESDIDSE 356 >BC000120-1|AAH00120.1| 517|Homo sapiens general transcription factor IIF, polypeptide 1, 74kDa protein. Length = 517 Score = 35.1 bits (77), Expect = 0.23 Identities = 19/55 (34%), Positives = 29/55 (52%) Frame = +1 Query: 457 DCQIDIQEESNQSDSNKEDSQEQALDIKPSMEPEKATNQVSLESDNYSISDVNSE 621 D Q D EES + +ED +E+ P+ + +K S ESD+ SD++SE Sbjct: 302 DEQSDSSEESEEEKPPEEDKEEEEEKKAPTPQEKKRRKDSSEESDSSEESDIDSE 356 >X15949-1|CAA34073.1| 349|Homo sapiens protein ( Human mRNA for interferon regulatory factor-2 (IRF-2). ). Length = 349 Score = 33.5 bits (73), Expect = 0.72 Identities = 20/63 (31%), Positives = 32/63 (50%) Frame = +1 Query: 451 KPDCQIDIQEESNQSDSNKEDSQEQALDIKPSMEPEKATNQVSLESDNYSISDVNSELPQ 630 KPD Q+ I+EESN N Q L + SM P ++++ E+ S+ S++ Q Sbjct: 285 KPDLQVTIKEESNPVPYNSSWPPFQDLPLSSSMTPASSSSRPDRET-RASVIKKTSDITQ 343 Query: 631 PKV 639 +V Sbjct: 344 ARV 346 >CR457077-1|CAG33358.1| 349|Homo sapiens IRF2 protein. Length = 349 Score = 33.5 bits (73), Expect = 0.72 Identities = 20/63 (31%), Positives = 32/63 (50%) Frame = +1 Query: 451 KPDCQIDIQEESNQSDSNKEDSQEQALDIKPSMEPEKATNQVSLESDNYSISDVNSELPQ 630 KPD Q+ I+EESN N Q L + SM P ++++ E+ S+ S++ Q Sbjct: 285 KPDLQVTIKEESNPVPYNSSWPPFQDLPLSSSMTPASSSSRPDRET-RASVIKKTSDITQ 343 Query: 631 PKV 639 +V Sbjct: 344 ARV 346 >BT007264-1|AAP35928.1| 349|Homo sapiens interferon regulatory factor 2 protein. Length = 349 Score = 33.5 bits (73), Expect = 0.72 Identities = 20/63 (31%), Positives = 32/63 (50%) Frame = +1 Query: 451 KPDCQIDIQEESNQSDSNKEDSQEQALDIKPSMEPEKATNQVSLESDNYSISDVNSELPQ 630 KPD Q+ I+EESN N Q L + SM P ++++ E+ S+ S++ Q Sbjct: 285 KPDLQVTIKEESNPVPYNSSWPPFQDLPLSSSMTPASSSSRPDRET-RASVIKKTSDITQ 343 Query: 631 PKV 639 +V Sbjct: 344 ARV 346 >BC015803-1|AAH15803.1| 349|Homo sapiens interferon regulatory factor 2 protein. Length = 349 Score = 33.5 bits (73), Expect = 0.72 Identities = 20/63 (31%), Positives = 32/63 (50%) Frame = +1 Query: 451 KPDCQIDIQEESNQSDSNKEDSQEQALDIKPSMEPEKATNQVSLESDNYSISDVNSELPQ 630 KPD Q+ I+EESN N Q L + SM P ++++ E+ S+ S++ Q Sbjct: 285 KPDLQVTIKEESNPVPYNSSWPPFQDLPLSSSMTPASSSSRPDRET-RASVIKKTSDITQ 343 Query: 631 PKV 639 +V Sbjct: 344 ARV 346 >U94319-1|AAB52589.1| 351|Homo sapiens DFS70 protein. Length = 351 Score = 30.3 bits (65), Expect = 6.7 Identities = 18/67 (26%), Positives = 29/67 (43%) Frame = +1 Query: 475 QEESNQSDSNKEDSQEQALDIKPSMEPEKATNQVSLESDNYSISDVNSELPQPKVLNANE 654 QEE K+D + Q + KP EP+K + +ES +++ P + Sbjct: 43 QEEKQPKKQPKKDEEGQKEEDKPRKEPDKKEGKKEVESKRKNLAKTGVTSPSDSE-EEGD 101 Query: 655 EPEIEKK 675 + E EKK Sbjct: 102 DQEGEKK 108 >AJ640137-1|CAG26691.1| 2697|Homo sapiens delangin protein. Length = 2697 Score = 29.9 bits (64), Expect = 8.8 Identities = 20/67 (29%), Positives = 33/67 (49%) Frame = +1 Query: 469 DIQEESNQSDSNKEDSQEQALDIKPSMEPEKATNQVSLESDNYSISDVNSELPQPKVLNA 648 D ++E S S + +S + ++ P K+ +V +SD+ S D+NS + K L Sbjct: 2475 DKRKERKSSPSKENESSDSEEEVS---RPRKSRKRVDSDSDSDSEDDINSVM---KCLPE 2528 Query: 649 NEEPEIE 669 N P IE Sbjct: 2529 NSAPLIE 2535 >AJ627032-1|CAF25290.1| 2804|Homo sapiens delangin protein. Length = 2804 Score = 29.9 bits (64), Expect = 8.8 Identities = 20/67 (29%), Positives = 33/67 (49%) Frame = +1 Query: 469 DIQEESNQSDSNKEDSQEQALDIKPSMEPEKATNQVSLESDNYSISDVNSELPQPKVLNA 648 D ++E S S + +S + ++ P K+ +V +SD+ S D+NS + K L Sbjct: 2475 DKRKERKSSPSKENESSDSEEEVS---RPRKSRKRVDSDSDSDSEDDINSVM---KCLPE 2528 Query: 649 NEEPEIE 669 N P IE Sbjct: 2529 NSAPLIE 2535 >AB019602-1|BAA77349.1| 2158|Homo sapiens IDN3-B protein. Length = 2158 Score = 29.9 bits (64), Expect = 8.8 Identities = 20/67 (29%), Positives = 33/67 (49%) Frame = +1 Query: 469 DIQEESNQSDSNKEDSQEQALDIKPSMEPEKATNQVSLESDNYSISDVNSELPQPKVLNA 648 D ++E S S + +S + ++ P K+ +V +SD+ S D+NS + K L Sbjct: 1936 DKRKERKSSPSKENESSDSEEEVS---RPRKSRKRVDSDSDSDSEDDINSVM---KCLPE 1989 Query: 649 NEEPEIE 669 N P IE Sbjct: 1990 NSAPLIE 1996 >AB019494-1|BAA77335.1| 2265|Homo sapiens IDN3 protein. Length = 2265 Score = 29.9 bits (64), Expect = 8.8 Identities = 20/67 (29%), Positives = 33/67 (49%) Frame = +1 Query: 469 DIQEESNQSDSNKEDSQEQALDIKPSMEPEKATNQVSLESDNYSISDVNSELPQPKVLNA 648 D ++E S S + +S + ++ P K+ +V +SD+ S D+NS + K L Sbjct: 1936 DKRKERKSSPSKENESSDSEEEVS---RPRKSRKRVDSDSDSDSEDDINSVM---KCLPE 1989 Query: 649 NEEPEIE 669 N P IE Sbjct: 1990 NSAPLIE 1996 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.297 0.119 0.302 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 67,750,054 Number of Sequences: 237096 Number of extensions: 1137327 Number of successful extensions: 1837 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 1768 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1837 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7783251346 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 17 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 44 (21.9 bits)
- SilkBase 1999-2023 -