BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0390 (328 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 4.3 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 20 5.7 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 20 5.7 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 20 5.7 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 20 5.7 AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory recept... 20 5.7 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 20.6 bits (41), Expect = 4.3 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 208 KPSQRSRSTEKMLLWKMTTILLNTVTLEHKTST 306 KPS ST W TT T T TST Sbjct: 1038 KPSTWWSSTTTSPWWTTTTTRRTTTTRPTTTST 1070 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 20.2 bits (40), Expect = 5.7 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +3 Query: 222 ITLDRKDAVVENDY 263 I++DRK + EN Y Sbjct: 717 ISVDRKAVIAENTY 730 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 20.2 bits (40), Expect = 5.7 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +3 Query: 222 ITLDRKDAVVENDY 263 I++DRK + EN Y Sbjct: 717 ISVDRKAVIAENTY 730 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 20.2 bits (40), Expect = 5.7 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +3 Query: 222 ITLDRKDAVVENDY 263 I++DRK + EN Y Sbjct: 717 ISVDRKAVIAENTY 730 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 20.2 bits (40), Expect = 5.7 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +3 Query: 222 ITLDRKDAVVENDY 263 I++DRK + EN Y Sbjct: 717 ISVDRKAVIAENTY 730 >AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory receptor candidate 34 protein. Length = 324 Score = 20.2 bits (40), Expect = 5.7 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +1 Query: 271 LNTVTLEHKTSTIGAFFHL 327 L T+ L T G FFH+ Sbjct: 280 LKTLVLNFPKFTAGGFFHV 298 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 73,121 Number of Sequences: 336 Number of extensions: 1298 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 49 effective length of database: 106,121 effective search space used: 6261139 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -