BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0390 (328 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF128536-1|AAD41781.1| 486|Homo sapiens cytoplasmic phosphoprot... 29 4.4 AK093081-1|BAC04046.1| 534|Homo sapiens protein ( Homo sapiens ... 28 5.8 BC126450-1|AAI26451.1| 297|Homo sapiens coiled-coil domain cont... 28 7.7 BC126448-1|AAI26449.1| 297|Homo sapiens coiled-coil domain cont... 28 7.7 AY685273-1|AAT96424.1| 102|Homo sapiens immunoglobulin variable... 28 7.7 AK027247-1|BAB15706.1| 297|Homo sapiens protein ( Homo sapiens ... 28 7.7 >AF128536-1|AAD41781.1| 486|Homo sapiens cytoplasmic phosphoprotein PACSIN2 protein. Length = 486 Score = 28.7 bits (61), Expect = 4.4 Identities = 16/51 (31%), Positives = 28/51 (54%), Gaps = 7/51 (13%) Frame = +3 Query: 153 KMISENFSVSGSNED----MPSKTQSTITLDR---KDAVVENDYNPFEHSD 284 K ++ F+++G N+ +PSK ST+ + + A ++ YNPFE D Sbjct: 318 KKATDGFTLTGINQTGDQFLPSKPSSTLNVPSNPAQSAQSQSSYNPFEDED 368 >AK093081-1|BAC04046.1| 534|Homo sapiens protein ( Homo sapiens cDNA FLJ35762 fis, clone TESTI2004793, moderately similar to Homo sapiens NY-REN-2 antigen mRNA. ). Length = 534 Score = 28.3 bits (60), Expect = 5.8 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +1 Query: 208 KPSQRSRSTEKMLLWKMTTILLNTVTLEHKTSTIGAFFH 324 KP SR T+++ L K+ +L T +H TS F H Sbjct: 476 KPVTNSRDTQEVPLEKVKQVLKIIATFKHTTSIFDDFAH 514 >BC126450-1|AAI26451.1| 297|Homo sapiens coiled-coil domain containing 102B protein. Length = 297 Score = 27.9 bits (59), Expect = 7.7 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +1 Query: 139 LRNHLK*FRKILVSAAAMRTCHQKPSQRSRSTEKMLLWK 255 L+ HL F+KIL MRT +K +R S + WK Sbjct: 44 LQVHLDEFQKILWKEREMRTALEKEIERLESALSLWKWK 82 >BC126448-1|AAI26449.1| 297|Homo sapiens coiled-coil domain containing 102B protein. Length = 297 Score = 27.9 bits (59), Expect = 7.7 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +1 Query: 139 LRNHLK*FRKILVSAAAMRTCHQKPSQRSRSTEKMLLWK 255 L+ HL F+KIL MRT +K +R S + WK Sbjct: 44 LQVHLDEFQKILWKEREMRTALEKEIERLESALSLWKWK 82 >AY685273-1|AAT96424.1| 102|Homo sapiens immunoglobulin variable region VL kappa domain protein. Length = 102 Score = 27.9 bits (59), Expect = 7.7 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = -1 Query: 208 FDGMSSLLPLTLKFSEIILNDFSAVYCNHNT 116 F G S TL S + DF+ YC H T Sbjct: 62 FSGSGSGTEFTLTISSLQSEDFAVYYCQHET 92 >AK027247-1|BAB15706.1| 297|Homo sapiens protein ( Homo sapiens cDNA: FLJ23594 fis, clone LNG14867. ). Length = 297 Score = 27.9 bits (59), Expect = 7.7 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +1 Query: 139 LRNHLK*FRKILVSAAAMRTCHQKPSQRSRSTEKMLLWK 255 L+ HL F+KIL MRT +K +R S + WK Sbjct: 44 LQVHLDEFQKILWKEREMRTALEKEIERLESALSLWKWK 82 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 42,993,788 Number of Sequences: 237096 Number of extensions: 689249 Number of successful extensions: 6616 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6585 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6616 length of database: 76,859,062 effective HSP length: 79 effective length of database: 58,128,478 effective search space used: 1685725862 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -