BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0388 (681 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21647| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_7527| Best HMM Match : DSL (HMM E-Value=2.5e-34) 29 4.6 SB_7148| Best HMM Match : MoCF_biosynth (HMM E-Value=3.6e-26) 28 6.1 >SB_21647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 340 Score = 29.1 bits (62), Expect = 3.5 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +3 Query: 198 CKL*QISGICTYCSCTKVHFTKEILFAVYST 290 C L + C CSCT++H+ +++ F T Sbjct: 247 CVLIYLMNFCVECSCTQIHWFRDMQFVFVLT 277 >SB_7527| Best HMM Match : DSL (HMM E-Value=2.5e-34) Length = 542 Score = 28.7 bits (61), Expect = 4.6 Identities = 17/44 (38%), Positives = 21/44 (47%), Gaps = 2/44 (4%) Frame = -1 Query: 585 ESHNVHTRYNVIKLILGNSIWMN--EGIPCNTLILPFNDQ*LIY 460 E H V TR +V I G I G+ C+T +P NDQ Y Sbjct: 407 ERHCVRTRNSVCSNITGERICNKGWHGVNCDTYCMPRNDQNAAY 450 >SB_7148| Best HMM Match : MoCF_biosynth (HMM E-Value=3.6e-26) Length = 501 Score = 28.3 bits (60), Expect = 6.1 Identities = 18/44 (40%), Positives = 26/44 (59%), Gaps = 6/44 (13%) Frame = +2 Query: 491 ISVLQGIPSFIHMEFPRI-NLI-----TLYLVCTL*LSCSDALV 604 + VL GIP FI +FP I NL+ + + +CT+ LS +A V Sbjct: 155 VFVLPGIPEFIQKDFPIIENLLLHPDSSKFYLCTIFLSSDEAEV 198 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,925,066 Number of Sequences: 59808 Number of extensions: 437292 Number of successful extensions: 766 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 703 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 766 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1757375282 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -