BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0388 (681 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z83129-5|CAB05643.1| 349|Caenorhabditis elegans Hypothetical pr... 28 5.4 AL032646-7|CAA21680.1| 485|Caenorhabditis elegans Hypothetical ... 28 5.4 >Z83129-5|CAB05643.1| 349|Caenorhabditis elegans Hypothetical protein W06G6.8 protein. Length = 349 Score = 28.3 bits (60), Expect = 5.4 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +3 Query: 327 TLFISIFSCFYYFAKFYLNTW 389 T I++ +Y+++KFYL W Sbjct: 143 TFIINVLISYYFYSKFYLQAW 163 >AL032646-7|CAA21680.1| 485|Caenorhabditis elegans Hypothetical protein Y54E2A.8 protein. Length = 485 Score = 28.3 bits (60), Expect = 5.4 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = -2 Query: 392 VPGV*IKFGKIIETRKNRNKQGIKVPLPKPNCQLGRVD 279 +P K GK+ E K R+ +G PL K N Q RVD Sbjct: 378 IPPSATKPGKLTENGKYRDNKGRLQPLLKMNIQFKRVD 415 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,801,041 Number of Sequences: 27780 Number of extensions: 339697 Number of successful extensions: 728 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 711 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 728 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1550199966 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -