BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0387 (684 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_06_0087 + 20771329-20771450,20771462-20771771,20771893-207726... 40 0.002 11_06_0690 + 26303733-26306540 37 0.013 12_02_0814 - 23410278-23411854,23411933-23412166,23412688-234127... 37 0.017 10_08_0817 - 20792817-20793360,20794061-20794156,20795193-20795296 36 0.023 05_03_0184 + 9339939-9340896,9341003-9341083,9341166-9341383,934... 35 0.052 05_01_0512 - 4259162-4259849,4260209-4260432,4260854-4261071,426... 34 0.12 03_05_0893 + 28566436-28566501,28566624-28566903,28567002-285671... 34 0.12 11_06_0152 + 20669949-20670326,20670887-20670997,20671079-206712... 33 0.16 05_01_0148 - 985745-986180,986290-986385,986498-986694,986824-98... 33 0.28 03_02_0609 - 9823120-9823573,9823903-9824102,9824240-9824335,982... 33 0.28 09_06_0293 + 22086359-22086496,22086604-22087213,22087407-220879... 31 1.1 10_08_0379 - 17373533-17374147 30 1.5 08_02_0929 + 22694917-22695072,22695399-22695781,22698637-226987... 30 1.5 05_05_0253 - 23632907-23633646,23633758-23635050,23636471-23636663 30 1.5 02_05_0255 - 27184306-27184914,27185009-27185272 30 1.5 04_04_0752 - 27791126-27791167,27791792-27791863,27792771-277928... 29 2.6 09_06_0234 - 21747724-21747839,21748027-21748096,21749157-217492... 29 3.4 12_01_1028 + 10541350-10541685,10542140-10542828,10542896-10542998 29 4.5 11_03_0226 - 11908455-11908562,11915971-11916240,11916463-119169... 29 4.5 12_02_0133 - 14057469-14057497,14057516-14057581,14057770-140583... 28 7.9 06_01_0460 + 3276855-3277967 28 7.9 05_05_0103 - 22408832-22410041,22410500-22410628,22411600-224117... 28 7.9 02_04_0581 - 24068122-24068355,24068693-24068906,24069675-240697... 28 7.9 >09_06_0087 + 20771329-20771450,20771462-20771771,20771893-20772672, 20772854-20774002 Length = 786 Score = 39.9 bits (89), Expect = 0.002 Identities = 15/39 (38%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = -2 Query: 512 QCFNCCRFGHTKVQCRSKPRCFKCG-QGHTGDTCNVEED 399 +CF C GH K C P C++C GH C V+ D Sbjct: 70 RCFRCLGLGHLKASCSQPPTCYRCWYPGHIERNCKVDID 108 >11_06_0690 + 26303733-26306540 Length = 935 Score = 37.1 bits (82), Expect = 0.013 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -2 Query: 512 QCFNCCRFGHTKVQCRSKPRCFKC 441 +CF C GH K C+ PRC++C Sbjct: 93 RCFCCLGLGHLKADCKGAPRCYRC 116 >12_02_0814 - 23410278-23411854,23411933-23412166,23412688-23412725, 23412872-23412948 Length = 641 Score = 36.7 bits (81), Expect = 0.017 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -2 Query: 509 CFNCCRFGHTKVQCRSKPRCFKCG-QGHTGDTC 414 CFNC GH K C RC+ C GH C Sbjct: 132 CFNCLGLGHQKSACPGSTRCYNCWYSGHIARNC 164 >10_08_0817 - 20792817-20793360,20794061-20794156,20795193-20795296 Length = 247 Score = 36.3 bits (80), Expect = 0.023 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Frame = -2 Query: 509 CFNCCRFGHTKVQCRSKPRCFKCGQ-GHTGDTCNVEEDCVSCCLCSGLHFASSKKCPE 339 C NC + GH +C ++ C C + GH C E C + C SG H A ++CP+ Sbjct: 124 CSNCYKPGHLAAECTNEKACNNCRKSGHLARNCPNEPVC-NLCNVSG-HLA--RECPK 177 Score = 35.5 bits (78), Expect = 0.040 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Frame = -2 Query: 524 YPTIQCFNCCRFGHTKVQCRSKPRCFKCG-QGHTGDTCNVEEDCVSC 387 +P C NC R GH C + C CG GH C+ ++ C +C Sbjct: 36 FPNDLCNNCKRPGHFARDCPNVALCHACGLPGHIAAECSSKDLCWNC 82 Score = 29.1 bits (62), Expect = 3.4 Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = -2 Query: 509 CFNCCRFGHTKVQCRSKPRCFKCGQ-GHTGDTCN 411 C+NC GH C ++ C CG+ GH C+ Sbjct: 79 CWNCKEPGHMANSCPNEGICRNCGKSGHIARECS 112 Score = 27.9 bits (59), Expect = 7.9 Identities = 15/49 (30%), Positives = 21/49 (42%), Gaps = 8/49 (16%) Frame = -2 Query: 509 CFNCCRFGHTKVQCRSKPR-------CFKCGQ-GHTGDTCNVEEDCVSC 387 C NC + GH +C + P C C + GH C E+ C +C Sbjct: 98 CRNCGKSGHIARECSAPPMLPGEMRLCSNCYKPGHLAAECTNEKACNNC 146 >05_03_0184 + 9339939-9340896,9341003-9341083,9341166-9341383, 9341796-9342019,9342409-9343096 Length = 722 Score = 35.1 bits (77), Expect = 0.052 Identities = 32/89 (35%), Positives = 40/89 (44%), Gaps = 4/89 (4%) Frame = -2 Query: 302 ENSLSYIEASKLHPPISKSFADIVSSLPTKSVPG-GNTVLPGS---PSSRTISYKKTVFT 135 E+SLS EA K S S + + S P+++V G+ V GS P S I Y K T Sbjct: 63 ESSLSISEADK-----SPSHSSMASPSPSRAVESTGSPVHRGSQLTPPSTKIHYMKAAGT 117 Query: 134 KPRTPPQHSKGFDHVAHESLVRDYNMPEP 48 KP T D V ES V + P P Sbjct: 118 KPLTFTIDPSAADFVGQESPVSTFVPPPP 146 >05_01_0512 - 4259162-4259849,4260209-4260432,4260854-4261071, 4261154-4261234,4261342-4262299 Length = 722 Score = 33.9 bits (74), Expect = 0.12 Identities = 31/89 (34%), Positives = 40/89 (44%), Gaps = 4/89 (4%) Frame = -2 Query: 302 ENSLSYIEASKLHPPISKSFADIVSSLPTKSVPG-GNTVLPGS---PSSRTISYKKTVFT 135 E+SLS EA K S S + + S P++++ G+ V GS P S I Y K T Sbjct: 63 ESSLSISEADK-----SPSHSSMASPSPSQALESTGSPVHRGSQLTPPSTKIHYMKAAGT 117 Query: 134 KPRTPPQHSKGFDHVAHESLVRDYNMPEP 48 KP T D V ES V + P P Sbjct: 118 KPLTITIDPSAADFVGQESPVSTFVPPPP 146 >03_05_0893 + 28566436-28566501,28566624-28566903,28567002-28567188, 28567353-28567423,28567523-28567600,28567687-28567774, 28567875-28567930,28568054-28568121 Length = 297 Score = 33.9 bits (74), Expect = 0.12 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = -2 Query: 500 CCRFGHTKVQCRSKPRCFKCGQGHTGDTCNVEEDCVSC 387 CC F K C + C +CG+G C + DC SC Sbjct: 173 CCHFCRQKKLC-GEEGCKRCGEGDLNQPCIGKTDCSSC 209 >11_06_0152 + 20669949-20670326,20670887-20670997,20671079-20671280, 20671393-20671675,20672145-20672234,20672366-20672473, 20672595-20672975,20673250-20673324,20673685-20673797, 20676233-20676742,20676807-20677300 Length = 914 Score = 33.5 bits (73), Expect = 0.16 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 4/36 (11%) Frame = -2 Query: 509 CFNCCRFGHTKVQC---RSKPRCFKCGQ-GHTGDTC 414 CFNC GH V C + K CF CG GH C Sbjct: 179 CFNCGEEGHVAVNCPMEKRKRPCFVCGLFGHNSKQC 214 >05_01_0148 - 985745-986180,986290-986385,986498-986694,986824-986919, 987020-987059,987751-987857 Length = 323 Score = 32.7 bits (71), Expect = 0.28 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 4/39 (10%) Frame = -2 Query: 518 TIQCFNCCRFGHTKVQCRS---KPRCFKCGQ-GHTGDTC 414 T +CFNC GH C++ K +C++CG+ GH C Sbjct: 101 TGRCFNCGIDGHWARDCKAGDWKNKCYRCGERGHIERNC 139 >03_02_0609 - 9823120-9823573,9823903-9824102,9824240-9824335, 9824454-9824567,9824711-9824774,9825206-9825312 Length = 344 Score = 32.7 bits (71), Expect = 0.28 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 4/39 (10%) Frame = -2 Query: 518 TIQCFNCCRFGHTKVQCRS---KPRCFKCGQ-GHTGDTC 414 T +CFNC GH C++ K +C++CG+ GH C Sbjct: 148 TGRCFNCGIDGHWARDCKAGDWKNKCYRCGERGHIERNC 186 >09_06_0293 + 22086359-22086496,22086604-22087213,22087407-22087938, 22088617-22089151 Length = 604 Score = 30.7 bits (66), Expect = 1.1 Identities = 13/41 (31%), Positives = 17/41 (41%) Frame = -2 Query: 458 PRCFKCGQGHTGDTCNVEEDCVSCCLCSGLHFASSKKCPEY 336 PRC C G D ++ C LC G + CPE+ Sbjct: 316 PRCSSCDGGEERDDIDMVMTCCGAVLCRGCAEVNPCGCPEW 356 >10_08_0379 - 17373533-17374147 Length = 204 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = -2 Query: 170 SRTISYKKTVFTKPRTPPQHSKGFDHVAHESLVRDYNMPEPSNGCA 33 +R +SY+K KP P + D A+ +L ++MP P G A Sbjct: 158 ARGVSYEKKKRKKPPHPSSAAAAHDDAANGALHHHHHMPPPPPGAA 203 >08_02_0929 + 22694917-22695072,22695399-22695781,22698637-22698769, 22698870-22699312,22699786-22699864 Length = 397 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = -2 Query: 194 TVLPGSPSSRTISYKKTVFTKPRTPPQHSKGFDHVAHESL 75 T LP +P S S K+ + P TPP +S+ H H SL Sbjct: 213 TPLPTTPKSEDESLKEDI---PATPPLNSERLPHTLHRSL 249 >05_05_0253 - 23632907-23633646,23633758-23635050,23636471-23636663 Length = 741 Score = 30.3 bits (65), Expect = 1.5 Identities = 12/34 (35%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = -2 Query: 512 QCFNCCRFGHTKVQCRSKPRCFKCGQ-GHTGDTC 414 +CF C H CR RC+ C + GH C Sbjct: 261 KCFRCFASDHQAAACRDPIRCYTCRRSGHISFRC 294 Score = 29.1 bits (62), Expect = 3.4 Identities = 12/44 (27%), Positives = 21/44 (47%) Frame = -2 Query: 584 QVLPKRVFMCYNSMPVKLYIYPTIQCFNCCRFGHTKVQCRSKPR 453 ++L + F C+ S I+C+ C R GH +C +K + Sbjct: 256 EILHGKCFRCFASDHQAAACRDPIRCYTCRRSGHISFRCPNKSK 299 >02_05_0255 - 27184306-27184914,27185009-27185272 Length = 290 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/48 (33%), Positives = 22/48 (45%) Frame = -2 Query: 155 YKKTVFTKPRTPPQHSKGFDHVAHESLVRDYNMPEPSNGCALPSSSNA 12 + KT T PR P + KGF E L + PE + P++S A Sbjct: 181 HAKTEATLPRAPEEEKKGFLDKIKEKLPGGHKKPEDATAVPPPAASPA 228 >04_04_0752 - 27791126-27791167,27791792-27791863,27792771-27792855, 27792971-27793236,27794117-27794301,27794925-27795018, 27795193-27795284,27795401-27795539,27796101-27796385 Length = 419 Score = 29.5 bits (63), Expect = 2.6 Identities = 23/75 (30%), Positives = 29/75 (38%), Gaps = 14/75 (18%) Frame = -2 Query: 509 CFNCCRFGHTKVQCRSKP---------RCFKC-GQGHTGDTCNVEEDCV----SCCLCSG 372 C+NC GH+ +C KP CF C QGH C + + CC G Sbjct: 122 CYNCGESGHSLSKC-PKPIENGGTKFASCFVCKQQGHLSKNCPENKHGIYPKGGCCKICG 180 Query: 371 LHFASSKKCPEYVRQ 327 +K CP RQ Sbjct: 181 EVTHLAKHCPNRGRQ 195 >09_06_0234 - 21747724-21747839,21748027-21748096,21749157-21749294, 21749389-21749493,21750157-21750527,21750612-21750694, 21750803-21751063,21751425-21751606,21752539-21752649, 21752727-21752798,21752883-21753036,21753329-21753341, 21754015-21754084,21754409-21754485,21754582-21754640, 21755327-21755580 Length = 711 Score = 29.1 bits (62), Expect = 3.4 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +3 Query: 93 MIKTFTVLRRSSGFSEDCFFIRYC 164 M+ T + RR +GF+ED F R C Sbjct: 291 MVSTLHIFRRVTGFTEDIIFSRNC 314 >12_01_1028 + 10541350-10541685,10542140-10542828,10542896-10542998 Length = 375 Score = 28.7 bits (61), Expect = 4.5 Identities = 12/35 (34%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = -2 Query: 515 IQCFNCCRFGHTKVQCRSKPRCFKC-GQGHTGDTC 414 I+CF C R GH + C + + C GH C Sbjct: 136 IKCFECGREGHHQATCPNPHLYYSCHNTGHISSHC 170 >11_03_0226 - 11908455-11908562,11915971-11916240,11916463-11916946, 11917148-11918060,11918628-11919300 Length = 815 Score = 28.7 bits (61), Expect = 4.5 Identities = 18/46 (39%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = -2 Query: 476 VQCRSKPRCFKCGQ-GHTGDTCNVEEDCVSCCLCSGLHFASSKKCP 342 V+ +K C KC + GH D C VE V C +C S KCP Sbjct: 375 VKGAAKKVCSKCFEKGHVADDCVVE---VYCDICDSFDHV-SHKCP 416 >12_02_0133 - 14057469-14057497,14057516-14057581,14057770-14058363, 14058450-14058570,14058926-14059320,14059410-14059534, 14059646-14059876,14060012-14060484,14060587-14060693, 14060842-14061172,14061222-14061250,14061345-14061901, 14062170-14062255,14062344-14062406,14062646-14063001, 14063101-14063356 Length = 1272 Score = 27.9 bits (59), Expect = 7.9 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -2 Query: 311 TMAENSLSYIEASKLHPPISKSFADIV-SSLPTKSVPGGNTVLP 183 +++EN+ +SK+HP +S SF D V SL S G + P Sbjct: 1117 SLSENTSDGRLSSKVHPLVSSSFDDSVDQSLAGSSKCNGKRIFP 1160 >06_01_0460 + 3276855-3277967 Length = 370 Score = 27.9 bits (59), Expect = 7.9 Identities = 24/100 (24%), Positives = 38/100 (38%), Gaps = 2/100 (2%) Frame = -2 Query: 329 QTDIKVTMAENSLSYIEASKL--HPPISKSFADIVSSLPTKSVPGGNTVLPGSPSSRTIS 156 +TD++V + +E K+ H D LP VP +PGSP + + Sbjct: 208 RTDLEVLKLSSLYQELEQGKVLDHGQYLAGDGDGYPLLPWLMVPFRGPAVPGSPEAEFNA 267 Query: 155 YKKTVFTKPRTPPQHSKGFDHVAHESLVRDYNMPEPSNGC 36 K R + KG+ +A +RD P + C Sbjct: 268 AHDATCRKARRTVRSLKGWGAIAR---LRDEESPRAAVAC 304 >05_05_0103 - 22408832-22410041,22410500-22410628,22411600-22411703, 22411780-22411874,22412483-22412540,22412741-22412792, 22415399-22415532 Length = 593 Score = 27.9 bits (59), Expect = 7.9 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = -2 Query: 170 SRTISYKKTVFTKPRTPPQHSKGFDHVAHESLVR 69 SR + + +T TPP H KG D ++ ES++R Sbjct: 404 SRNVMHSPNGYT---TPPTHGKGSDQLSVESILR 434 >02_04_0581 - 24068122-24068355,24068693-24068906,24069675-24069755, 24069853-24070024,24070806-24070884,24071384-24071477, 24072065-24072147,24072284-24072401,24072457-24072461 Length = 359 Score = 27.9 bits (59), Expect = 7.9 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -2 Query: 416 CNVEEDCVSCCLCSGLHFASSKKC 345 C+ + C C C GL+ + SK C Sbjct: 56 CSADSTCKDDCECRGLYMSCSKNC 79 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,169,622 Number of Sequences: 37544 Number of extensions: 444764 Number of successful extensions: 1274 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 1223 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1271 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1733104716 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -