BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0387 (684 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_32385| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_30386| Best HMM Match : zf-CCHC (HMM E-Value=0.0024) 43 2e-04 SB_54041| Best HMM Match : Peptidase_A17 (HMM E-Value=4.5e-11) 42 4e-04 SB_43219| Best HMM Match : zf-CCHC (HMM E-Value=0.0056) 42 5e-04 SB_21302| Best HMM Match : Peptidase_A17 (HMM E-Value=3.8e-27) 42 5e-04 SB_54145| Best HMM Match : zf-CCHC (HMM E-Value=0.021) 40 0.002 SB_27574| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_34393| Best HMM Match : RVT_1 (HMM E-Value=2e-36) 37 0.017 SB_15012| Best HMM Match : zf-CCHC (HMM E-Value=1.1e-05) 36 0.023 SB_29912| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00036) 36 0.031 SB_49583| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.040 SB_54032| Best HMM Match : Peptidase_A17 (HMM E-Value=5.20022e-42) 35 0.071 SB_7017| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.071 SB_49565| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.093 SB_36817| Best HMM Match : rve (HMM E-Value=6.2e-36) 34 0.093 SB_56362| Best HMM Match : zf-CCHC (HMM E-Value=0.0015) 34 0.12 SB_53919| Best HMM Match : zf-CCHC (HMM E-Value=0.0015) 34 0.12 SB_48157| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_37538| Best HMM Match : zf-CCHC (HMM E-Value=0.0011) 34 0.12 SB_31343| Best HMM Match : zf-CCHC (HMM E-Value=0.0015) 34 0.12 SB_35377| Best HMM Match : Peptidase_A17 (HMM E-Value=0) 33 0.16 SB_20246| Best HMM Match : RVT_1 (HMM E-Value=1.4e-30) 33 0.16 SB_25887| Best HMM Match : Peptidase_A17 (HMM E-Value=0) 33 0.16 SB_49286| Best HMM Match : Laminin_N (HMM E-Value=0) 33 0.22 SB_29838| Best HMM Match : EGF (HMM E-Value=1.2e-15) 33 0.22 SB_16016| Best HMM Match : RVT_1 (HMM E-Value=9.7e-08) 33 0.28 SB_16748| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_16404| Best HMM Match : RVT_1 (HMM E-Value=9.7e-08) 33 0.28 SB_27878| Best HMM Match : zf-CCHC (HMM E-Value=0.00046) 32 0.38 SB_6849| Best HMM Match : EGF_2 (HMM E-Value=9.3e-11) 32 0.38 SB_27540| Best HMM Match : Laminin_EGF (HMM E-Value=5.4e-12) 32 0.38 SB_21351| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.38 SB_16657| Best HMM Match : RVT_1 (HMM E-Value=6.4e-18) 32 0.38 SB_16017| Best HMM Match : Peptidase_A17 (HMM E-Value=1.2e-19) 32 0.38 SB_18397| Best HMM Match : Peptidase_A17 (HMM E-Value=8.1e-32) 32 0.50 SB_22256| Best HMM Match : zf-CCHC (HMM E-Value=0.0025) 32 0.50 SB_11559| Best HMM Match : Peptidase_A17 (HMM E-Value=3.8e-33) 32 0.50 SB_13566| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.66 SB_28983| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.66 SB_19905| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.66 SB_21594| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_33872| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_4030| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_9846| Best HMM Match : DUF605 (HMM E-Value=0.046) 31 1.1 SB_16363| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 1.4 SB_31362| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_9510| Best HMM Match : Keratin_B2 (HMM E-Value=3.8e-05) 30 1.5 SB_395| Best HMM Match : Peptidase_A17 (HMM E-Value=5.9e-05) 30 1.5 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 30 1.5 SB_22953| Best HMM Match : EGF_2 (HMM E-Value=1.3e-14) 30 1.5 SB_21616| Best HMM Match : RVT_1 (HMM E-Value=0.00011) 30 1.5 SB_51085| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_19913| Best HMM Match : zf-C2H2 (HMM E-Value=8.9e-08) 30 2.0 SB_56562| Best HMM Match : Lipase_GDSL (HMM E-Value=0.25) 30 2.0 SB_55492| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_151| Best HMM Match : zf-CCHC (HMM E-Value=8.9e-05) 30 2.0 SB_31380| Best HMM Match : zf-CCHC (HMM E-Value=4.6e-05) 29 2.7 SB_14079| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_23731| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_12773| Best HMM Match : DUF1480 (HMM E-Value=2.1) 29 2.7 SB_11191| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_51966| Best HMM Match : zf-CCHC (HMM E-Value=0.00038) 29 3.5 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_42955| Best HMM Match : Oxidored_q1_N (HMM E-Value=4.4) 29 3.5 SB_6909| Best HMM Match : UPAR_LY6 (HMM E-Value=0.017) 29 3.5 SB_42797| Best HMM Match : Peptidase_A16_N (HMM E-Value=2e-05) 29 3.5 SB_30367| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_55209| Best HMM Match : WRKY (HMM E-Value=1.1) 29 4.6 SB_28310| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_20978| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_56579| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_47717| Best HMM Match : EGF (HMM E-Value=1.9e-29) 28 6.1 SB_39530| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_32721| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_20117| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_12727| Best HMM Match : zf-CHY (HMM E-Value=3.7e-34) 28 6.1 SB_54100| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_53888| Best HMM Match : TSP_3 (HMM E-Value=9.2e-11) 28 6.1 SB_43428| Best HMM Match : Glyco_hydro_47 (HMM E-Value=0) 28 6.1 SB_33873| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_33392| Best HMM Match : zf-CCHC (HMM E-Value=0.043) 28 6.1 SB_16967| Best HMM Match : Laminin_EGF (HMM E-Value=0) 28 6.1 SB_45717| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_37504| Best HMM Match : PIP5K (HMM E-Value=0) 28 8.1 SB_24791| Best HMM Match : FYVE (HMM E-Value=7.2e-14) 28 8.1 SB_24593| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_2459| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_48624| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_48269| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_47894| Best HMM Match : CI-B14_5a (HMM E-Value=6.6) 28 8.1 SB_40159| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_33889| Best HMM Match : zf-CCHC (HMM E-Value=2.1e-05) 28 8.1 SB_28337| Best HMM Match : zf-CCHC (HMM E-Value=6e-06) 28 8.1 SB_24095| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_10751| Best HMM Match : TNFR_c6 (HMM E-Value=7.6e-17) 28 8.1 SB_6077| Best HMM Match : EGF (HMM E-Value=0) 28 8.1 >SB_32385| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1322 Score = 43.2 bits (97), Expect = 2e-04 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = -2 Query: 515 IQCFNCCRFGHTKVQCRSKPRCFKCGQGHTGDTC 414 ++CFNC GHT+ C RC CG H D C Sbjct: 526 LRCFNCSESGHTRAACYMDQRCMLCGGSHEVDDC 559 >SB_30386| Best HMM Match : zf-CCHC (HMM E-Value=0.0024) Length = 90 Score = 43.2 bits (97), Expect = 2e-04 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = -2 Query: 515 IQCFNCCRFGHTKVQCRSKPRCFKCGQGHTGDTC 414 ++CFNC GHT+ C RC CG H D C Sbjct: 18 LRCFNCSESGHTRAACYMDQRCMLCGGSHEVDDC 51 >SB_54041| Best HMM Match : Peptidase_A17 (HMM E-Value=4.5e-11) Length = 1461 Score = 42.3 bits (95), Expect = 4e-04 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = -2 Query: 509 CFNCCRFGHTKVQCRSKPRCFKCGQGHTGDTCN 411 CFNC + H +C+SK CFKC Q H C+ Sbjct: 286 CFNCTKGKHRAEECKSKSNCFKCKQRHDTSICD 318 >SB_43219| Best HMM Match : zf-CCHC (HMM E-Value=0.0056) Length = 693 Score = 41.9 bits (94), Expect = 5e-04 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = -2 Query: 509 CFNCCRFGHTKVQCRSKPRCFKCGQGHTGDTCN 411 CFNC + H +C+SK CFKC Q H C+ Sbjct: 263 CFNCTKGKHRAEECKSKSNCFKCKQRHHTSICD 295 >SB_21302| Best HMM Match : Peptidase_A17 (HMM E-Value=3.8e-27) Length = 1290 Score = 41.9 bits (94), Expect = 5e-04 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = -2 Query: 509 CFNCCRFGHTKVQCRSKPRCFKCGQGHTGDTCN 411 CFNC + H +C+SK CFKC Q H C+ Sbjct: 328 CFNCTKRKHRAEECKSKSNCFKCKQRHHTSICD 360 >SB_54145| Best HMM Match : zf-CCHC (HMM E-Value=0.021) Length = 286 Score = 39.9 bits (89), Expect = 0.002 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -2 Query: 509 CFNCCRFGHTKVQCRSKPRCFKCGQGHTGDTCN 411 CFNC + H +C+SK CFKC + H C+ Sbjct: 23 CFNCTKGKHHAEECKSKSNCFKCKRRHHTSICD 55 >SB_27574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1258 Score = 39.5 bits (88), Expect = 0.002 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -2 Query: 509 CFNCCRFGHTKVQCRSKPRCFKCGQGHTGDTCN 411 CFNC + + +C+SK CFKC Q H C+ Sbjct: 246 CFNCTKGKYRAEECKSKSNCFKCKQRHHTSICD 278 >SB_34393| Best HMM Match : RVT_1 (HMM E-Value=2e-36) Length = 1198 Score = 36.7 bits (81), Expect = 0.017 Identities = 28/93 (30%), Positives = 40/93 (43%), Gaps = 2/93 (2%) Frame = -2 Query: 515 IQCFNCCRFGHTKVQCRSKP--RCFKCGQGHTGDTCNVEEDCVSCCLCSGLHFASSKKCP 342 ++C C + GH CRSKP R + H G+ V L + K P Sbjct: 21 VRCDKCTKVGHFAAVCRSKPNTRVSQVEDAHEGEVLEHNPTFVGRVLAVP---QTDNKLP 77 Query: 341 EYVRQTDIKVTMAENSLSYIEASKLHPPISKSF 243 + + DI T +EN +S +EA L P IS + Sbjct: 78 DQDKNVDI--TSSENQVSEVEA--LMPEISTDY 106 >SB_15012| Best HMM Match : zf-CCHC (HMM E-Value=1.1e-05) Length = 410 Score = 36.3 bits (80), Expect = 0.023 Identities = 20/52 (38%), Positives = 26/52 (50%), Gaps = 3/52 (5%) Frame = -2 Query: 560 MCYNSMPVKLYIYP--TIQCFNCCRFGHTKVQCRSKPRCFKCG-QGHTGDTC 414 M S P+KL+ YP +C C + GH C + RCF+CG GH C Sbjct: 134 MRLRSFPIKLW-YPGQPAECGYCHQVGHPISTCPVRGRCFRCGAAGHVVARC 184 >SB_29912| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00036) Length = 618 Score = 35.9 bits (79), Expect = 0.031 Identities = 27/92 (29%), Positives = 38/92 (41%), Gaps = 3/92 (3%) Frame = -2 Query: 638 NNTPTWKPSQTVVFTFDGQVLPKRVFMCYNSMPVKLYIYP--TIQCFNCCRFGHTKVQCR 465 N+ TWK T+ D +P+ + + S P+KL+ YP Q C + H C Sbjct: 41 NDIETWKRVVTMRLVRD---VPRNLRV--RSFPIKLW-YPGQPTQFAYCHQMAHLISSCP 94 Query: 464 SKPRCFKCG-QGHTGDTCNVEEDCVSCCLCSG 372 + RCFKCG G C +D G Sbjct: 95 VRGRCFKCGAPGRFAARCRAPDDAAGAVTQGG 126 >SB_49583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 35.5 bits (78), Expect = 0.040 Identities = 16/44 (36%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = -2 Query: 521 PTIQCFNCCRFGHTKVQCRSKPRCFKCGQ-GHTGDTCNVEEDCV 393 P C+ C + GH C +C+KCG GH C EED + Sbjct: 119 PGESCYRCGKSGHFARDCTDDTKCYKCGNTGHIRRDC-PEEDAM 161 >SB_54032| Best HMM Match : Peptidase_A17 (HMM E-Value=5.20022e-42) Length = 832 Score = 34.7 bits (76), Expect = 0.071 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -2 Query: 509 CFNCCRFGHTKVQCRSKPRCFKCGQGHTGDTC 414 C+NC H +C SK RC +CG H C Sbjct: 103 CYNCLSSSHISSKCTSKFRCRQCGGKHHTTIC 134 >SB_7017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1017 Score = 34.7 bits (76), Expect = 0.071 Identities = 28/93 (30%), Positives = 39/93 (41%), Gaps = 2/93 (2%) Frame = -2 Query: 515 IQCFNCCRFGHTKVQCRSKP--RCFKCGQGHTGDTCNVEEDCVSCCLCSGLHFASSKKCP 342 ++C C + GH V CRSKP R + H G+ V L + P Sbjct: 185 VRCDKCTKVGHFAVVCRSKPNTRVSQVEDAHEGEVLEHNPTFVGRVLAVP---QTDNTLP 241 Query: 341 EYVRQTDIKVTMAENSLSYIEASKLHPPISKSF 243 + + DI T +EN +S EA L P IS + Sbjct: 242 DQDKNVDI--TSSENQVSQAEA--LMPEISTDY 270 >SB_49565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1571 Score = 34.3 bits (75), Expect = 0.093 Identities = 27/93 (29%), Positives = 39/93 (41%), Gaps = 2/93 (2%) Frame = -2 Query: 515 IQCFNCCRFGHTKVQCRSKP--RCFKCGQGHTGDTCNVEEDCVSCCLCSGLHFASSKKCP 342 ++C C + GH CRSKP R + H G+ + V L + P Sbjct: 233 VRCDKCTKVGHFAAVCRSKPNTRVSQVVDAHEGEVLEHNQTFVGRVLAVP---QTDNTLP 289 Query: 341 EYVRQTDIKVTMAENSLSYIEASKLHPPISKSF 243 + + DI T +EN +S EA L P IS + Sbjct: 290 DQDKNVDI--TSSENQVS--EAEALMPEISTDY 318 >SB_36817| Best HMM Match : rve (HMM E-Value=6.2e-36) Length = 924 Score = 34.3 bits (75), Expect = 0.093 Identities = 18/60 (30%), Positives = 29/60 (48%) Frame = -2 Query: 467 RSKPRCFKCGQGHTGDTCNVEEDCVSCCLCSGLHFASSKKCPEYVRQTDIKVTMAENSLS 288 R RC+ CG+GH C + S C + S CPE + Q ++ ++A +SL+ Sbjct: 183 RPSKRCYFCGEGHYAKVCK-SKGAASIC-------SISAACPENLAQASVEASIAGHSLT 234 >SB_56362| Best HMM Match : zf-CCHC (HMM E-Value=0.0015) Length = 468 Score = 33.9 bits (74), Expect = 0.12 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -2 Query: 509 CFNCCRFGHTKVQCRSKPRCFKCGQGHTGDTCN 411 CFNC R GH + +C + C+KC H C+ Sbjct: 112 CFNCGRTGHRENKCNGR-GCYKCKARHHTSLCH 143 >SB_53919| Best HMM Match : zf-CCHC (HMM E-Value=0.0015) Length = 289 Score = 33.9 bits (74), Expect = 0.12 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -2 Query: 509 CFNCCRFGHTKVQCRSKPRCFKCGQGHTGDTCN 411 CFNC R GH + +C + C+KC H C+ Sbjct: 175 CFNCGRTGHRENKCNGR-GCYKCKARHHTSLCH 206 >SB_48157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1306 Score = 33.9 bits (74), Expect = 0.12 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -2 Query: 509 CFNCCRFGHTKVQCRSKPRCFKCGQGHTGDTCN 411 CFNC R GH + +C + C+KC H C+ Sbjct: 337 CFNCGRTGHRENKCNGR-GCYKCKARHHTSLCH 368 >SB_37538| Best HMM Match : zf-CCHC (HMM E-Value=0.0011) Length = 215 Score = 33.9 bits (74), Expect = 0.12 Identities = 25/93 (26%), Positives = 40/93 (43%), Gaps = 2/93 (2%) Frame = -2 Query: 515 IQCFNCCRFGHTKVQCRSKP--RCFKCGQGHTGDTCNVEEDCVSCCLCSGLHFASSKKCP 342 ++C C + GH CRSKP R + H G+ V L + P Sbjct: 93 VRCDKCTKVGHIAAVCRSKPNTRVSQVEDAHEGEVLEHNPTFVGRVLAVP---QTDNTLP 149 Query: 341 EYVRQTDIKVTMAENSLSYIEASKLHPPISKSF 243 + + ++++T +EN +S EA L P IS + Sbjct: 150 D--QDKNVEITSSENQVS--EAEALMPEISTDY 178 >SB_31343| Best HMM Match : zf-CCHC (HMM E-Value=0.0015) Length = 449 Score = 33.9 bits (74), Expect = 0.12 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -2 Query: 509 CFNCCRFGHTKVQCRSKPRCFKCGQGHTGDTCN 411 CFNC R GH + +C + C+KC H C+ Sbjct: 112 CFNCGRTGHRENKCNGR-GCYKCKARHHTSLCH 143 >SB_35377| Best HMM Match : Peptidase_A17 (HMM E-Value=0) Length = 1400 Score = 33.5 bits (73), Expect = 0.16 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = -2 Query: 509 CFNCCRFGHTKVQCRSKPRCFKCGQGHTGDTCNVEE 402 C+NC H +C SK RC +CG H D ++++ Sbjct: 416 CYNCLSSSHISFKCTSKFRCRQCG-AHQEDEFDLQQ 450 >SB_20246| Best HMM Match : RVT_1 (HMM E-Value=1.4e-30) Length = 1191 Score = 33.5 bits (73), Expect = 0.16 Identities = 27/93 (29%), Positives = 38/93 (40%), Gaps = 2/93 (2%) Frame = -2 Query: 515 IQCFNCCRFGHTKVQCRSKP--RCFKCGQGHTGDTCNVEEDCVSCCLCSGLHFASSKKCP 342 ++C C + GH CRSKP R + H G+ V L + P Sbjct: 235 VRCDKCTKVGHFAAVCRSKPNTRVSQVEDAHEGEVLEHNPTFVGRVLAVP---QTDNTLP 291 Query: 341 EYVRQTDIKVTMAENSLSYIEASKLHPPISKSF 243 + + DI T +EN +S EA L P IS + Sbjct: 292 DQDKNVDI--TSSENQVS--EAKALMPEISTDY 320 >SB_25887| Best HMM Match : Peptidase_A17 (HMM E-Value=0) Length = 1378 Score = 33.5 bits (73), Expect = 0.16 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = -2 Query: 509 CFNCCRFGHTKVQCRSKPRCFKCGQGHTGDTCNVEE 402 C+NC H +C SK RC +CG H D ++++ Sbjct: 395 CYNCLSSSHISFKCTSKFRCRQCG-AHQEDEFDLQQ 429 >SB_49286| Best HMM Match : Laminin_N (HMM E-Value=0) Length = 1465 Score = 33.1 bits (72), Expect = 0.22 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = -2 Query: 509 CFNC-CRFGHTKVQCRSKPRCFKCGQGHTGDTCNVEED 399 C C C+FG +Q + C C +GH G+ C++ +D Sbjct: 752 CKKCPCKFGTRCIQIGANVVCTDCPEGHVGNLCDMCQD 789 >SB_29838| Best HMM Match : EGF (HMM E-Value=1.2e-15) Length = 373 Score = 33.1 bits (72), Expect = 0.22 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = -2 Query: 506 FNCCRFGHTKVQCRS-KPRCFKCGQGHTGDTCNVEEDCVS 390 F C G +V C++ +PRC C G +GD C ++C S Sbjct: 234 FTCSNGGTCEVDCKTLRPRCH-CLAGFSGDKCENIDECAS 272 >SB_16016| Best HMM Match : RVT_1 (HMM E-Value=9.7e-08) Length = 890 Score = 32.7 bits (71), Expect = 0.28 Identities = 25/93 (26%), Positives = 38/93 (40%), Gaps = 2/93 (2%) Frame = -2 Query: 515 IQCFNCCRFGHTKVQCRSKP--RCFKCGQGHTGDTCNVEEDCVSCCLCSGLHFASSKKCP 342 ++C C + GH CRSKP R + H G+ V L + P Sbjct: 86 VRCDKCTKVGHFDAVCRSKPNTRVSQVEDAHEGEVLQHNPTFVGQVLAVS---QTDNTLP 142 Query: 341 EYVRQTDIKVTMAENSLSYIEASKLHPPISKSF 243 + + ++ T +EN +S EA L P IS + Sbjct: 143 D--QDKNVNTTSSENQVS--EAEALMPEISTDY 171 >SB_16748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 280 Score = 32.7 bits (71), Expect = 0.28 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 3/48 (6%) Frame = -2 Query: 506 FNCCRFGHTKVQCRSK-PRCFKCGQGHTGDTC-NVEEDCVSC-CLCSG 372 F C G ++ C++ PRC C +G +GD C N + +C S C SG Sbjct: 133 FTCSNGGTCEIDCKTLVPRCL-CPEGFSGDKCENHDNECQSSPCKNSG 179 >SB_16404| Best HMM Match : RVT_1 (HMM E-Value=9.7e-08) Length = 765 Score = 32.7 bits (71), Expect = 0.28 Identities = 25/93 (26%), Positives = 38/93 (40%), Gaps = 2/93 (2%) Frame = -2 Query: 515 IQCFNCCRFGHTKVQCRSKP--RCFKCGQGHTGDTCNVEEDCVSCCLCSGLHFASSKKCP 342 ++C C + GH CRSKP R + H G+ V L + P Sbjct: 68 VRCDKCTKVGHFDAVCRSKPNTRVSQVEDAHEGEVLQHNPTFVGQVLAVS---QTDNTLP 124 Query: 341 EYVRQTDIKVTMAENSLSYIEASKLHPPISKSF 243 + + ++ T +EN +S EA L P IS + Sbjct: 125 D--QDKNVNTTSSENQVS--EAEALMPEISTDY 153 >SB_27878| Best HMM Match : zf-CCHC (HMM E-Value=0.00046) Length = 338 Score = 32.3 bits (70), Expect = 0.38 Identities = 21/67 (31%), Positives = 29/67 (43%), Gaps = 3/67 (4%) Frame = -2 Query: 512 QCFNCCRFGHTKVQCR--SKPRCFKCGQ-GHTGDTCNVEEDCVSCCLCSGLHFASSKKCP 342 +C C R GH CR +C KCG+ GH C ++ SG S + P Sbjct: 88 RCHRCNRQGHKAADCRCSKNHQCEKCGKIGHFKVCCKSKQTSGKAKSASGP--KSKGRKP 145 Query: 341 EYVRQTD 321 +VRQ + Sbjct: 146 SHVRQVE 152 >SB_6849| Best HMM Match : EGF_2 (HMM E-Value=9.3e-11) Length = 439 Score = 32.3 bits (70), Expect = 0.38 Identities = 20/55 (36%), Positives = 24/55 (43%) Frame = -2 Query: 509 CFNCCRFGHTKVQCRSKPRCFKCGQGHTGDTCNVEEDCVSCCLCSGLHFASSKKC 345 C NC G T C + P C G+TG TC V++ C C S A K C Sbjct: 44 CNNCSSVGGT---CSAGPDTCACRPGYTGPTCAVQK-CDGCGHGSCQISAGKKSC 94 >SB_27540| Best HMM Match : Laminin_EGF (HMM E-Value=5.4e-12) Length = 674 Score = 32.3 bits (70), Expect = 0.38 Identities = 26/103 (25%), Positives = 42/103 (40%), Gaps = 3/103 (2%) Frame = -2 Query: 503 NCCRFGHTKVQCRS---KPRCFKCGQGHTGDTCNVEEDCVSCCLCSGLHFASSKKCPEYV 333 +C R C+ +P C +C +G+ + + E C C C+ + P + Sbjct: 313 SCARVSSGNCTCKKYVREPTCGQCMKGYFNLSSSNPEGC-QACNCNPKGTLGGDRTPAEI 371 Query: 332 RQTDIKVTMAENSLSYIEASKLHPPISKSFADIVSSLPTKSVP 204 T + A +S + AS P SK FA I +S T +P Sbjct: 372 HCTS-QNPQANSSAVVVMASVPALPTSKGFAAINASPLTTGIP 413 >SB_21351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 558 Score = 32.3 bits (70), Expect = 0.38 Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -2 Query: 509 CFNCCRFGHTKVQCRSKPRCFKC-GQGHT 426 C+NC H +C SK RC +C G+ HT Sbjct: 416 CYNCLSSSHISSKCTSKFRCRQCRGKHHT 444 >SB_16657| Best HMM Match : RVT_1 (HMM E-Value=6.4e-18) Length = 1138 Score = 32.3 bits (70), Expect = 0.38 Identities = 20/68 (29%), Positives = 30/68 (44%), Gaps = 3/68 (4%) Frame = -2 Query: 515 IQCFNCCRFGHTKVQCR--SKPRCFKCGQ-GHTGDTCNVEEDCVSCCLCSGLHFASSKKC 345 ++C C + GH CR +C KCG+ GH C ++ SG S + Sbjct: 155 VRCHRCNKQGHKAADCRCSKNHQCEKCGKIGHFKVCCKSKQTSGKAKSASGP--KSKGRK 212 Query: 344 PEYVRQTD 321 P +VRQ + Sbjct: 213 PSHVRQVE 220 >SB_16017| Best HMM Match : Peptidase_A17 (HMM E-Value=1.2e-19) Length = 879 Score = 32.3 bits (70), Expect = 0.38 Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -2 Query: 509 CFNCCRFGHTKVQCRSKPRCFKC-GQGHT 426 C+NC H +C SK RC +C G+ HT Sbjct: 215 CYNCLSSSHISSKCTSKFRCRQCGGKRHT 243 >SB_18397| Best HMM Match : Peptidase_A17 (HMM E-Value=8.1e-32) Length = 1626 Score = 31.9 bits (69), Expect = 0.50 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = -2 Query: 509 CFNCCRFGHTKVQCRSKPRCFKCGQGHTGDTCN 411 C+NC + GH +C++ C KC H C+ Sbjct: 305 CYNCTKGGHMATKCKA-GNCAKCNSRHHTSICD 336 >SB_22256| Best HMM Match : zf-CCHC (HMM E-Value=0.0025) Length = 238 Score = 31.9 bits (69), Expect = 0.50 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -2 Query: 509 CFNCCRFGHTKVQCRSKPRC 450 CF+C + GH + +CRSK +C Sbjct: 19 CFSCLKRGHPQRECRSKKKC 38 >SB_11559| Best HMM Match : Peptidase_A17 (HMM E-Value=3.8e-33) Length = 1485 Score = 31.9 bits (69), Expect = 0.50 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = -2 Query: 509 CFNCCRFGHTKVQCRSKPRCFKCGQGHTGDTCN 411 C+NC + GH +C++ C KC H C+ Sbjct: 199 CYNCTKGGHMATKCKA-GNCAKCNSRHHTSICD 230 >SB_13566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1008 Score = 31.5 bits (68), Expect = 0.66 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = -2 Query: 509 CFNCCRFGHTKVQCRSKPRCFKCGQGHTGDTCNVEE 402 C+NC H +C SK RC +C + H D ++++ Sbjct: 314 CYNCLSSSHISSKCTSKFRCRQC-EAHQEDKFDLQQ 348 >SB_28983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 951 Score = 31.5 bits (68), Expect = 0.66 Identities = 33/126 (26%), Positives = 53/126 (42%), Gaps = 19/126 (15%) Frame = -2 Query: 524 YPTIQCFNCCRFGHTKVQCRS------------KPR--CFKCGQG-HTGDTCNVEE-DCV 393 Y +C NC + GH K C+S KP+ C +CG H G +C ++ C Sbjct: 512 YKKYKCDNCGKVGHLKRVCQSKECKKXXXXQGGKPKTACHRCGSAEHDGKSCKYKKYKCD 571 Query: 392 SCCLCSGL-HFASSKKCPE--YVRQTDIKVTMAENSLSYIEASKLHPPISKSFADIVSSL 222 +C L SK+C E YV + + + SL + + P SK+ + ++ Sbjct: 572 NCGKVGHLKRVCQSKECKETKYV-EVSVDNDQEDESLGFFSTRE---PSSKA-VTVTITV 626 Query: 221 PTKSVP 204 K +P Sbjct: 627 NGKEIP 632 >SB_19905| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 587 Score = 31.5 bits (68), Expect = 0.66 Identities = 27/90 (30%), Positives = 36/90 (40%), Gaps = 2/90 (2%) Frame = -2 Query: 515 IQCFNCCRFGHTKVQCRSKP--RCFKCGQGHTGDTCNVEEDCVSCCLCSGLHFASSKKCP 342 ++C C + GH CRSKP R + H G+ V L + P Sbjct: 185 VRCDKCTKVGHFVAVCRSKPNTRVSQVEDAHEGEVLEHNPTFVGRVLAVP---QTDNTLP 241 Query: 341 EYVRQTDIKVTMAENSLSYIEASKLHPPIS 252 + DI T +EN +S EA L P IS Sbjct: 242 NQDKNVDI--TSSENQVS--EAEALMPEIS 267 >SB_21594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1075 Score = 31.1 bits (67), Expect = 0.87 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -2 Query: 506 FNCCRFGHTKVQCRSK-PRCFKCGQGHTGDTCNVEEDCVSC 387 F C G +V C++ PRC C +G +GD C E+D C Sbjct: 474 FTCSNGGTCEVDCKTLVPRCH-CPEGFSGDKC--EDDINEC 511 >SB_33872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 716 Score = 31.1 bits (67), Expect = 0.87 Identities = 28/91 (30%), Positives = 38/91 (41%), Gaps = 3/91 (3%) Frame = -2 Query: 305 AENSLSYIEASKLHPPISKSFADIVSS---LPTKSVPGGNTVLPGSPSSRTISYKKTVFT 135 A +L Y + K + P AD + LP V G T L G P + + +TV Sbjct: 154 AIGALIYTDPKK-YAPYGTDLADTFPNTWWLPGDGVQRGTT-LNGYPGAYRLKVNRTVIK 211 Query: 134 KPRTPPQHSKGFDHVAHESLVRDYNMPEPSN 42 P H+ G+D A E L R P PS+ Sbjct: 212 SLPRIPCHAIGYDD-AEEILARMSGSPAPSD 241 >SB_4030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 809 Score = 31.1 bits (67), Expect = 0.87 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Frame = -3 Query: 391 LAAYVLGCTLLRAKSVQST*DKQILK*QWQRIAYPILKRQNYIPPFLNHL-LILYP 227 LA Y ++L++ S+ +K + + I + + KRQNY+P L H+ L L P Sbjct: 176 LATYEQISSMLKSDSLNVISEKDVFEAVLAWIRHDLPKRQNYLPELLKHIRLTLLP 231 >SB_9846| Best HMM Match : DUF605 (HMM E-Value=0.046) Length = 811 Score = 30.7 bits (66), Expect = 1.1 Identities = 22/89 (24%), Positives = 38/89 (42%) Frame = -2 Query: 272 KLHPPISKSFADIVSSLPTKSVPGGNTVLPGSPSSRTISYKKTVFTKPRTPPQHSKGFDH 93 K + P S ++ SS P + P N P +PSS + KP P + K + Sbjct: 642 KSNSPASNPKSNNPSSNPKPNNPASNPK-PNNPSSNPKPNNPSSNPKPNNPASNPKPNNP 700 Query: 92 VAHESLVRDYNMPEPSNGCALPSSSNANS 6 ++ + P+P+N + P +N +S Sbjct: 701 ASNPKPNNPSSNPKPNNPASNPKPNNPSS 729 Score = 28.7 bits (61), Expect = 4.6 Identities = 22/89 (24%), Positives = 37/89 (41%) Frame = -2 Query: 272 KLHPPISKSFADIVSSLPTKSVPGGNTVLPGSPSSRTISYKKTVFTKPRTPPQHSKGFDH 93 K + P S + SS P + P N P +PSS + KP P + K + Sbjct: 357 KPNNPASNPKPNNPSSNPKPNNPSSNPK-PNNPSSNPKPNNPSSNPKPNNPSSNPKPNNP 415 Query: 92 VAHESLVRDYNMPEPSNGCALPSSSNANS 6 ++ + P+P+N + P +N +S Sbjct: 416 ASNPKPNNPSSNPKPNNPSSNPKPNNPSS 444 Score = 28.7 bits (61), Expect = 4.6 Identities = 22/89 (24%), Positives = 36/89 (40%) Frame = -2 Query: 272 KLHPPISKSFADIVSSLPTKSVPGGNTVLPGSPSSRTISYKKTVFTKPRTPPQHSKGFDH 93 K + P S + SS P + P N P +PSS KP P + K + Sbjct: 696 KPNNPASNPKPNNPSSNPKPNNPASNPK-PNNPSSNPKPNNPASNPKPNNPASNPKPNNP 754 Query: 92 VAHESLVRDYNMPEPSNGCALPSSSNANS 6 ++ + P+P+N + P +N +S Sbjct: 755 ASNPKPNNPASNPKPNNPASNPKPNNPSS 783 Score = 27.9 bits (59), Expect = 8.1 Identities = 21/89 (23%), Positives = 37/89 (41%) Frame = -2 Query: 272 KLHPPISKSFADIVSSLPTKSVPGGNTVLPGSPSSRTISYKKTVFTKPRTPPQHSKGFDH 93 K + P S + +S P + P N P +PSS + KP P + K + Sbjct: 492 KPNNPASNPKPNNPASNPKPNNPASNPK-PNNPSSNPKPNNPSSNPKPNNPSSNPKPNNP 550 Query: 92 VAHESLVRDYNMPEPSNGCALPSSSNANS 6 ++ + P+P+N + P +N +S Sbjct: 551 ASNPKPNNPSSNPKPNNPASNPKPNNPSS 579 >SB_16363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 709 Score = 27.5 bits (58), Expect(2) = 1.4 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -2 Query: 419 TCNVEEDCVSCCLCSGLHFASSKKCPEYVRQTD 321 +C + DC+ +CSG SS +CP+ V Q D Sbjct: 497 SCRNKTDCLDKAMCSG----SSVECPKSVYQPD 525 Score = 21.4 bits (43), Expect(2) = 1.4 Identities = 7/20 (35%), Positives = 10/20 (50%) Frame = -2 Query: 509 CFNCCRFGHTKVQCRSKPRC 450 C CR+ + CR+K C Sbjct: 485 CGRDCRYVGNDISCRNKTDC 504 >SB_31362| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 30.3 bits (65), Expect = 1.5 Identities = 23/89 (25%), Positives = 38/89 (42%) Frame = -2 Query: 272 KLHPPISKSFADIVSSLPTKSVPGGNTVLPGSPSSRTISYKKTVFTKPRTPPQHSKGFDH 93 K + P S + SS P + P N P +PSS + KP P + K + Sbjct: 153 KPNNPSSNPKPNNPSSNPKPNNPSSNPK-PNNPSSNPKPNNPSSNPKPNNPSSNPKSNNP 211 Query: 92 VAHESLVRDYNMPEPSNGCALPSSSNANS 6 ++ + P+P+N + P S+N +S Sbjct: 212 SSNPKPNNPSSNPKPNNPSSNPKSNNPSS 240 Score = 28.3 bits (60), Expect = 6.1 Identities = 22/89 (24%), Positives = 36/89 (40%) Frame = -2 Query: 272 KLHPPISKSFADIVSSLPTKSVPGGNTVLPGSPSSRTISYKKTVFTKPRTPPQHSKGFDH 93 K + P S + SS P + P N P +PSS KP P + K + Sbjct: 36 KPNNPSSNPKPNNPSSNPKPNNPASNPK-PNNPSSNPKPNNPASNPKPNNPASNPKPNNP 94 Query: 92 VAHESLVRDYNMPEPSNGCALPSSSNANS 6 ++ + P+P+N + P +N +S Sbjct: 95 ASNPKPNNPASNPKPNNPASNPKPNNPSS 123 >SB_9510| Best HMM Match : Keratin_B2 (HMM E-Value=3.8e-05) Length = 500 Score = 30.3 bits (65), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Frame = -2 Query: 509 CFNCCRFGHTKVQCRSKPRC--FKCGQGH 429 CF C R GH + CR +C C +GH Sbjct: 75 CFGCLRGGHQRRSCRRSQKCGVDGCDRGH 103 >SB_395| Best HMM Match : Peptidase_A17 (HMM E-Value=5.9e-05) Length = 659 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/37 (37%), Positives = 17/37 (45%) Frame = -2 Query: 527 IYPTIQCFNCCRFGHTKVQCRSKPRCFKCGQGHTGDT 417 +Y C NC + GH C S RC K G G + T Sbjct: 190 VYNKRLCRNCLKEGHFADSCPSSGRCLKEGYGPSSCT 226 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 30.3 bits (65), Expect = 1.5 Identities = 19/59 (32%), Positives = 25/59 (42%), Gaps = 5/59 (8%) Frame = -2 Query: 536 KLYIYPTIQCFNC--CRFGHTKVQ-CRSKP--RCFKCGQGHTGDTCNVEEDCVSCCLCS 375 K Y + C C CR GH + C +K C C G D ++ E C C +CS Sbjct: 151 KYYDTGLLFCKECTVCRVGHGATRPCSTKSDTECHPCEAGTFSDKESLSEPCRPCRVCS 209 >SB_22953| Best HMM Match : EGF_2 (HMM E-Value=1.3e-14) Length = 635 Score = 30.3 bits (65), Expect = 1.5 Identities = 18/63 (28%), Positives = 26/63 (41%), Gaps = 6/63 (9%) Frame = -2 Query: 512 QCFNCCRFGHTKVQCR-----SKPRCFK-CGQGHTGDTCNVEEDCVSCCLCSGLHFASSK 351 QC N R H CR + RC + C G+ GD C C++ C + + Sbjct: 187 QCQNRSRCNHVTGLCRCISGWTGKRCERPCDSGYYGDECKRVCQCMNGATCDHVTGRCDQ 246 Query: 350 KCP 342 +CP Sbjct: 247 RCP 249 >SB_21616| Best HMM Match : RVT_1 (HMM E-Value=0.00011) Length = 1380 Score = 30.3 bits (65), Expect = 1.5 Identities = 26/93 (27%), Positives = 37/93 (39%), Gaps = 2/93 (2%) Frame = -2 Query: 515 IQCFNCCRFGHTKVQCRSKP--RCFKCGQGHTGDTCNVEEDCVSCCLCSGLHFASSKKCP 342 ++C C + H CRSKP R + H G+ V L + P Sbjct: 220 VRCDKCTKVWHFAAVCRSKPNTRVSQVEDAHEGEVLEHNPTLVGRVLAVP---QTDNTLP 276 Query: 341 EYVRQTDIKVTMAENSLSYIEASKLHPPISKSF 243 + + DI T +EN +S EA L P IS + Sbjct: 277 DQDKNLDI--TSSENQVS--EAEALMPEISTDY 305 >SB_51085| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1251 Score = 29.9 bits (64), Expect = 2.0 Identities = 20/60 (33%), Positives = 27/60 (45%), Gaps = 2/60 (3%) Frame = -2 Query: 482 TKVQCRSKP-RCFKCGQGHTGDTCNVEEDCVSCCLCSGL-HFASSKKCPEYVRQTDIKVT 309 TK Q R P RC CG+ H N V C C+ + HFA+ + R + +K T Sbjct: 212 TKSQRRQTPDRCGYCGRDHPRGKINCPAANVRCDKCNKVGHFAAVCRSKPNTRVSQVKDT 271 >SB_19913| Best HMM Match : zf-C2H2 (HMM E-Value=8.9e-08) Length = 532 Score = 29.9 bits (64), Expect = 2.0 Identities = 21/62 (33%), Positives = 28/62 (45%), Gaps = 2/62 (3%) Frame = -2 Query: 185 PGSPSSRTISYKKTVFTKPRTP-PQHSKGFD-HVAHESLVRDYNMPEPSNGCALPSSSNA 12 P + T + KT P P PQHSKGF+ + V+ E +N A P S N+ Sbjct: 318 PATFKPLTSTTAKTAMVSPVKPSPQHSKGFELEITQPKTVKP--SVEMTNKVAFPPSPNS 375 Query: 11 NS 6 S Sbjct: 376 GS 377 >SB_56562| Best HMM Match : Lipase_GDSL (HMM E-Value=0.25) Length = 473 Score = 29.9 bits (64), Expect = 2.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -2 Query: 470 CRSKPRCFKCGQGHTGDTCN 411 CR K CF+CG H+ + C+ Sbjct: 208 CRFKHACFRCGASHSANLCS 227 >SB_55492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1303 Score = 29.9 bits (64), Expect = 2.0 Identities = 17/47 (36%), Positives = 21/47 (44%), Gaps = 5/47 (10%) Frame = -2 Query: 554 YNSMPVK---LYIYPTIQCFNCCRFGHTKVQCRSKPRCFK--CGQGH 429 + S P+K +Y C NC + GH C S RC K CG H Sbjct: 111 FKSKPLKERRKIVYNKRLCRNCLKEGHFADSCPSSGRCLKEGCGLKH 157 >SB_151| Best HMM Match : zf-CCHC (HMM E-Value=8.9e-05) Length = 1382 Score = 29.9 bits (64), Expect = 2.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 509 CFNCCRFGHTKVQCRSKPRC 450 CF+C R GH + +C SK +C Sbjct: 1130 CFSCLRRGHHQRECGSKKKC 1149 >SB_31380| Best HMM Match : zf-CCHC (HMM E-Value=4.6e-05) Length = 1082 Score = 29.5 bits (63), Expect = 2.7 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -2 Query: 512 QCFNCCRFGHTKVQCRSKP 456 +CF C + GH CRSKP Sbjct: 237 KCFKCSKVGHIANACRSKP 255 >SB_14079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 546 Score = 29.5 bits (63), Expect = 2.7 Identities = 13/32 (40%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = -2 Query: 506 FNCCRFGHTKVQCRS-KPRCFKCGQGHTGDTC 414 F C G +V C++ +PRC C G +GD C Sbjct: 133 FTCSNGGTCEVDCKTFRPRCH-CPAGFSGDKC 163 >SB_23731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1133 Score = 29.5 bits (63), Expect = 2.7 Identities = 14/35 (40%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = -2 Query: 527 IYPTIQCFNCCRFGHTKVQCRSKPRCFK--CGQGH 429 +Y C NC + GH C S RC K CG H Sbjct: 183 VYNKRLCRNCLKEGHFADSCPSSGRCLKEGCGLKH 217 >SB_12773| Best HMM Match : DUF1480 (HMM E-Value=2.1) Length = 505 Score = 29.5 bits (63), Expect = 2.7 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -2 Query: 449 FKCGQGHTGDTCNVEEDCVSCCL 381 + C + C++ E+CVSCCL Sbjct: 202 YNCESCQVNNCCSIYENCVSCCL 224 >SB_11191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1577 Score = 29.5 bits (63), Expect = 2.7 Identities = 12/34 (35%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = -2 Query: 512 QCFNCCRFGHTKVQCRSK-PRCFKCGQGHTGDTC 414 +CF C R H +C+SK C C H C Sbjct: 357 RCFRCLRKNHRSYECKSKDSNCKGCAGAHHLSIC 390 >SB_51966| Best HMM Match : zf-CCHC (HMM E-Value=0.00038) Length = 447 Score = 29.1 bits (62), Expect = 3.5 Identities = 12/37 (32%), Positives = 16/37 (43%) Frame = -2 Query: 512 QCFNCCRFGHTKVQCRSKPRCFKCGQGHTGDTCNVEE 402 +CF C + GH +C +K C C H C E Sbjct: 81 RCFICLKKGHRSNECFNKDGCSDCRGRHHVSICYERE 117 >SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 754 Score = 29.1 bits (62), Expect = 3.5 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Frame = -2 Query: 506 FNCCRFGHTKVQCRS-KPRCFKCGQGHTGDTC-NVEEDCVS 390 F C G +V C++ + RC C G +GD C N +++C S Sbjct: 186 FTCSNGGTCEVDCKTFRLRCH-CPAGFSGDKCENNDDECKS 225 >SB_42955| Best HMM Match : Oxidored_q1_N (HMM E-Value=4.4) Length = 435 Score = 29.1 bits (62), Expect = 3.5 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = -3 Query: 292 YPILKRQNYIPPFLNHLLILYPLSQLNLFLVEIQYCLVHHPHVQY 158 YPI R + P +L+ LYP+S + + L+H + Y Sbjct: 138 YPISYRTIHFSPLFTYLICLYPISYRTIHFSHLFTYLIHLYPISY 182 Score = 28.7 bits (61), Expect = 4.6 Identities = 13/45 (28%), Positives = 22/45 (48%) Frame = -3 Query: 292 YPILKRQNYIPPFLNHLLILYPLSQLNLFLVEIQYCLVHHPHVQY 158 YPI R + P + +L+ LYP+S + + L+H + Y Sbjct: 178 YPISYRTIHFSPLITYLIRLYPISYRTIHFSPLFTYLIHLYPISY 222 Score = 28.7 bits (61), Expect = 4.6 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = -3 Query: 292 YPILKRQNYIPPFLNHLLILYPLSQLNLFLVEIQYCLVHHPHVQY 158 YPI R + P +L+ LYP+S + + L+H + Y Sbjct: 218 YPISYRTIHFSPLFTYLIHLYPISYRTIHFSHLVTYLIHLYPISY 262 Score = 27.9 bits (59), Expect = 8.1 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = -3 Query: 292 YPILKRQNYIPPFLNHLLILYPLSQLNLFLVEIQYCLVHHPHVQY 158 YPI R + P +L+ LYP+S + + L+H + Y Sbjct: 198 YPISYRTIHFSPLFTYLIHLYPISYRTIHFSPLFTYLIHLYPISY 242 Score = 27.9 bits (59), Expect = 8.1 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = -3 Query: 292 YPILKRQNYIPPFLNHLLILYPLSQLNLFLVEIQYCLVHHPHVQY 158 YPI R + P +L+ LYP+S + + L+H + Y Sbjct: 358 YPISYRTIHFSPLFTYLINLYPISYRTIHFSPLFTYLIHLYPISY 402 Score = 27.9 bits (59), Expect = 8.1 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = -3 Query: 292 YPILKRQNYIPPFLNHLLILYPLSQLNLFLVEIQYCLVHHPHVQY 158 YPI R + P +L+ LYP+S + + L+H + Y Sbjct: 378 YPISYRTIHFSPLFTYLIHLYPISYRTIHFSPLFTYLIHLYPISY 422 >SB_6909| Best HMM Match : UPAR_LY6 (HMM E-Value=0.017) Length = 472 Score = 29.1 bits (62), Expect = 3.5 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -2 Query: 482 TKVQCRSKPRCFKCGQGHTGDTCNVEEDCVSC 387 T V ++P C+KC G + +TC V C Sbjct: 197 THVVTATRPLCYKCPPGTSAETCTQLPSTVQC 228 >SB_42797| Best HMM Match : Peptidase_A16_N (HMM E-Value=2e-05) Length = 668 Score = 29.1 bits (62), Expect = 3.5 Identities = 12/37 (32%), Positives = 16/37 (43%) Frame = -2 Query: 512 QCFNCCRFGHTKVQCRSKPRCFKCGQGHTGDTCNVEE 402 +CF C + GH +C +K C C H C E Sbjct: 357 RCFICLKKGHRSNECFNKDGCSDCRGRHHVSICYERE 393 >SB_30367| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 29.1 bits (62), Expect = 3.5 Identities = 16/54 (29%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Frame = -2 Query: 452 CFKCGQGHTGDTCNVEEDCVSCCLCSGLHFAS-SKKCPEYVRQTDIKVTMAENS 294 CF C G T + +D C C+ +H+A C +Y+ T VT E + Sbjct: 28 CFHCRTPLAGKTFQMRDDRKVCKDCNRIHYAKRCVACRQYIEGTVKFVTRDEGT 81 >SB_55209| Best HMM Match : WRKY (HMM E-Value=1.1) Length = 386 Score = 28.7 bits (61), Expect = 4.6 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = +2 Query: 335 RTLDTFCSKQSAAQNISSKIHSLPPHYKYLQCGPDH 442 R L+T S+ NISS + SLP Y Y+ P H Sbjct: 103 RYLETNYSRHCVRSNISSGLSSLPLPYVYVDNVPTH 138 >SB_28310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1051 Score = 28.7 bits (61), Expect = 4.6 Identities = 13/38 (34%), Positives = 15/38 (39%) Frame = -2 Query: 512 QCFNCCRFGHTKVQCRSKPRCFKCGQGHTGDTCNVEED 399 QC C + H +SK KC T D EED Sbjct: 127 QCIKCSKMNHFAKMYKSKVTSVKCVDDDTTDESTEEED 164 >SB_20978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1683 Score = 28.7 bits (61), Expect = 4.6 Identities = 11/29 (37%), Positives = 14/29 (48%), Gaps = 2/29 (6%) Frame = -2 Query: 509 CFNCCRFGHTKVQCRSKPRC--FKCGQGH 429 CF C R GH + C +C C +GH Sbjct: 462 CFGCLRGGHQRRSCSRSQKCGVDSCDRGH 490 >SB_56579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1042 Score = 28.3 bits (60), Expect = 6.1 Identities = 13/50 (26%), Positives = 24/50 (48%), Gaps = 2/50 (4%) Frame = -2 Query: 572 KRVFMCYNSMPVKLYIYPTIQCFNCCRFGHTK--VQCRSKPRCFKCGQGH 429 K+ +C + ++ Y QCF+ R GH++ + +P C C + H Sbjct: 991 KKCTVCGTQLLLQGYAKSHPQCFSIDRLGHSQGHYKWNVRPTCLSCNRRH 1040 >SB_47717| Best HMM Match : EGF (HMM E-Value=1.9e-29) Length = 214 Score = 28.3 bits (60), Expect = 6.1 Identities = 11/19 (57%), Positives = 13/19 (68%), Gaps = 1/19 (5%) Frame = -2 Query: 443 CGQGHTGDTCNVE-EDCVS 390 C G+TG TCNV DC+S Sbjct: 112 CNLGYTGSTCNVTVNDCIS 130 >SB_39530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1323 Score = 28.3 bits (60), Expect = 6.1 Identities = 14/45 (31%), Positives = 21/45 (46%), Gaps = 6/45 (13%) Frame = -2 Query: 503 NCCRFGHTKVQCR-----SKPRCFKC-GQGHTGDTCNVEEDCVSC 387 NCC F + R +K C+ C GH C +++ C+SC Sbjct: 322 NCCEFVKITLDERRAFIIAKGLCWGCLTWGHDNRNCKIKKTCISC 366 >SB_32721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 637 Score = 28.3 bits (60), Expect = 6.1 Identities = 17/58 (29%), Positives = 23/58 (39%), Gaps = 1/58 (1%) Frame = -2 Query: 506 FNC-CRFGHTKVQCRSKPRCFKCGQGHTGDTCNVEEDCVSCCLCSGLHFASSKKCPEY 336 + C C G+ C ++ +C K H G TC D C SG + K EY Sbjct: 419 YECTCLTGYKGHDCEAEAQC-KHAPCHNGGTCTELHDGFQCTCSSGYRGNTCKGDAEY 475 >SB_20117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 28.3 bits (60), Expect = 6.1 Identities = 22/89 (24%), Positives = 37/89 (41%) Frame = -2 Query: 272 KLHPPISKSFADIVSSLPTKSVPGGNTVLPGSPSSRTISYKKTVFTKPRTPPQHSKGFDH 93 K + P S + SS P + P N P +PSS + KP P + K + Sbjct: 72 KPNNPSSNPKPNNPSSNPKPNNPASNPK-PNNPSSNPKPNNPSSNPKPNNPSSNPKPNNP 130 Query: 92 VAHESLVRDYNMPEPSNGCALPSSSNANS 6 ++ + P+P+N + P +N +S Sbjct: 131 ASNPKPNNPASNPKPNNPSSNPKPNNPSS 159 >SB_12727| Best HMM Match : zf-CHY (HMM E-Value=3.7e-34) Length = 168 Score = 28.3 bits (60), Expect = 6.1 Identities = 17/60 (28%), Positives = 24/60 (40%) Frame = -2 Query: 452 CFKCGQGHTGDTCNVEEDCVSCCLCSGLHFASSKKCPEYVRQTDIKVTMAENSLSYIEAS 273 C CG G N C C +C G+ S KC + + D V + + S I A+ Sbjct: 90 CDACGICRIGGRKNFYH-CPRCDICLGVGLKDSHKCVDKSARNDCPVCLEDIHTSRISAN 148 >SB_54100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3287 Score = 28.3 bits (60), Expect = 6.1 Identities = 11/19 (57%), Positives = 13/19 (68%), Gaps = 1/19 (5%) Frame = -2 Query: 443 CGQGHTGDTCNVE-EDCVS 390 C G+TG TCNV DC+S Sbjct: 691 CNLGYTGSTCNVTVNDCIS 709 >SB_53888| Best HMM Match : TSP_3 (HMM E-Value=9.2e-11) Length = 1012 Score = 28.3 bits (60), Expect = 6.1 Identities = 18/48 (37%), Positives = 25/48 (52%) Frame = -2 Query: 263 PPISKSFADIVSSLPTKSVPGGNTVLPGSPSSRTISYKKTVFTKPRTP 120 PP++ S + + T + P T PGSPS+ T S T T P+TP Sbjct: 875 PPMT-SGPTTTTPISTSAAPEITTANPGSPSTTTKSV-TTPQTSPKTP 920 >SB_43428| Best HMM Match : Glyco_hydro_47 (HMM E-Value=0) Length = 758 Score = 28.3 bits (60), Expect = 6.1 Identities = 17/60 (28%), Positives = 24/60 (40%) Frame = -2 Query: 452 CFKCGQGHTGDTCNVEEDCVSCCLCSGLHFASSKKCPEYVRQTDIKVTMAENSLSYIEAS 273 C CG G N C C +C G+ S KC + + D V + + S I A+ Sbjct: 90 CDACGICRIGGRKNFYH-CPRCDICLGVGLKDSHKCVDKSARNDCPVCLEDIHTSRISAN 148 >SB_33873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1362 Score = 28.3 bits (60), Expect = 6.1 Identities = 12/34 (35%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = -2 Query: 512 QCFNCCRFGHTKVQCRSK-PRCFKCGQGHTGDTC 414 +CF C R + +CRSK C C H C Sbjct: 370 RCFRCLRKNYRSYECRSKDSNCKGCAGAHHLSIC 403 >SB_33392| Best HMM Match : zf-CCHC (HMM E-Value=0.043) Length = 348 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = -2 Query: 506 FNCCRFGHTKVQCRSKPRC 450 F+C + GH + +CRSK +C Sbjct: 18 FSCLKRGHPQRECRSKKKC 36 >SB_16967| Best HMM Match : Laminin_EGF (HMM E-Value=0) Length = 1706 Score = 28.3 bits (60), Expect = 6.1 Identities = 17/45 (37%), Positives = 22/45 (48%), Gaps = 6/45 (13%) Frame = -2 Query: 473 QCRSKP-----RCFKCGQGHTGDTCNVEEDCVSC-CLCSGLHFAS 357 QC KP RC +C GH G T + +C +C C SG A+ Sbjct: 417 QCSCKPNVYGRRCDQCIPGHWGFTLPPQGECKACNCNISGTRNAT 461 >SB_45717| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 721 Score = 27.9 bits (59), Expect = 8.1 Identities = 11/29 (37%), Positives = 14/29 (48%), Gaps = 2/29 (6%) Frame = -2 Query: 509 CFNCCRFGHTKVQCRSKPRC--FKCGQGH 429 CF C R GH + C +C C +GH Sbjct: 668 CFGCLRGGHQRRSCSRSQKCGVDGCDRGH 696 >SB_37504| Best HMM Match : PIP5K (HMM E-Value=0) Length = 2119 Score = 27.9 bits (59), Expect = 8.1 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = -2 Query: 554 YNSMPVKLYIYPTIQCFNCCRFGHTKVQCRSKPRCFKCGQGHTGDTCNVE 405 Y K Y P C C G R + C CGQ CNVE Sbjct: 118 YKESDFKQYWMPDETCKECYECGEKFNTFRRRHHCRLCGQIFCYRCCNVE 167 >SB_24791| Best HMM Match : FYVE (HMM E-Value=7.2e-14) Length = 64 Score = 27.9 bits (59), Expect = 8.1 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = -2 Query: 554 YNSMPVKLYIYPTIQCFNCCRFGHTKVQCRSKPRCFKCGQGHTGDTCNVE 405 Y K Y P C C G R + C CGQ CNVE Sbjct: 5 YKESDFKQYWMPDETCKECYECGEKFNTFRRRHHCRLCGQIFCYRCCNVE 54 >SB_24593| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1453 Score = 27.9 bits (59), Expect = 8.1 Identities = 12/29 (41%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Frame = -2 Query: 509 CFNCCRFGHTKVQCRSKPRCFKCG-QGHT 426 CF C + H RSK C +CG + HT Sbjct: 160 CFKCLKGPHLASDSRSKISCSECGKRNHT 188 >SB_2459| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1741 Score = 27.9 bits (59), Expect = 8.1 Identities = 16/60 (26%), Positives = 28/60 (46%) Frame = -2 Query: 185 PGSPSSRTISYKKTVFTKPRTPPQHSKGFDHVAHESLVRDYNMPEPSNGCALPSSSNANS 6 PG+ +IS+K + T R PP + F+ + SL +++ E N L + N+ Sbjct: 547 PGNLKRHSISHKAGLITFTRLPPSQVQVFEGTHNLSLTWSFHVVEGENIFTLSFNRGENT 606 >SB_48624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 813 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -2 Query: 512 QCFNCCRFGHTKVQCR 465 +C +C +FGHTK CR Sbjct: 84 RCHHCHKFGHTKRDCR 99 >SB_48269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1720 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = -2 Query: 509 CFNCCRFGHTKVQCRSKPRC 450 CF C + H +CRS RC Sbjct: 1002 CFRCLKQNHRGYECRSNDRC 1021 >SB_47894| Best HMM Match : CI-B14_5a (HMM E-Value=6.6) Length = 167 Score = 27.9 bits (59), Expect = 8.1 Identities = 16/55 (29%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Frame = -2 Query: 461 KPRCFKCGQGHTGDTCNVEEDCVSCC-LCSGLHFASSKKCPEYVRQTDIKVTMAE 300 K RC K G+ T +E+ SC L S H+ + ++ +IK+ AE Sbjct: 101 KERCLKHGKAEHSFTPELEQTVPSCSHLISANHYKKENLKRKNIKSINIKINHAE 155 >SB_40159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1497 Score = 27.9 bits (59), Expect = 8.1 Identities = 11/29 (37%), Positives = 14/29 (48%), Gaps = 2/29 (6%) Frame = -2 Query: 509 CFNCCRFGHTKVQCRSKPRC--FKCGQGH 429 CF C R GH + C +C C +GH Sbjct: 277 CFGCLRGGHQRRSCSRSQKCGVDGCDRGH 305 >SB_33889| Best HMM Match : zf-CCHC (HMM E-Value=2.1e-05) Length = 525 Score = 27.9 bits (59), Expect = 8.1 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -2 Query: 515 IQCFNCCRFGHTKVQCR 465 ++C++C +FGH K CR Sbjct: 254 LRCYHCHKFGHIKRDCR 270 >SB_28337| Best HMM Match : zf-CCHC (HMM E-Value=6e-06) Length = 521 Score = 27.9 bits (59), Expect = 8.1 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = -2 Query: 512 QCFNCCRFGHTKVQCRSKPRCFKCGQGHTG 423 +CF+C + GH K CR K HTG Sbjct: 57 KCFSCGKIGHIKRACRQVKPYEKPQATHTG 86 >SB_24095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1162 Score = 27.9 bits (59), Expect = 8.1 Identities = 11/29 (37%), Positives = 14/29 (48%), Gaps = 2/29 (6%) Frame = -2 Query: 509 CFNCCRFGHTKVQCRSKPRC--FKCGQGH 429 CF C R GH + C +C C +GH Sbjct: 8 CFGCLRGGHQRRSCSRSQKCGVDGCDRGH 36 >SB_10751| Best HMM Match : TNFR_c6 (HMM E-Value=7.6e-17) Length = 738 Score = 27.9 bits (59), Expect = 8.1 Identities = 19/63 (30%), Positives = 24/63 (38%), Gaps = 6/63 (9%) Frame = -2 Query: 515 IQCFNCCRFGHTKVQCRS------KPRCFKCGQGHTGDTCNVEEDCVSCCLCSGLHFASS 354 ++C NC +C S K RC C G T + N C C LC H Sbjct: 38 VKCPNCAEGHGLMPECGSHISYGDKFRCVPCTDGETYSSSNDLTSCRPCSLCP--HKKVI 95 Query: 353 KKC 345 +KC Sbjct: 96 QKC 98 >SB_6077| Best HMM Match : EGF (HMM E-Value=0) Length = 1165 Score = 27.9 bits (59), Expect = 8.1 Identities = 15/47 (31%), Positives = 27/47 (57%), Gaps = 2/47 (4%) Frame = -2 Query: 503 NCCRFGHTKVQCRSKPRCFKCGQGHTGDTCNVE-EDCVS-CCLCSGL 369 N C+ G + S +C C G+TG C+++ ++C+S CL +G+ Sbjct: 336 NPCQHGSACMDGVSSYQCI-CQPGYTGQYCHIDIDECLSRPCLNNGM 381 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,393,047 Number of Sequences: 59808 Number of extensions: 529927 Number of successful extensions: 2011 Number of sequences better than 10.0: 96 Number of HSP's better than 10.0 without gapping: 1670 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1988 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1769412099 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -