BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0382 (533 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. 23 4.9 AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. 23 4.9 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 23 8.5 >AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 23.4 bits (48), Expect = 4.9 Identities = 16/60 (26%), Positives = 23/60 (38%), Gaps = 1/60 (1%) Frame = -3 Query: 195 SDPMALSRTSVSNLFLAEPVSSPIPTSGRNWNDPLA-NR*GKEKRTRVWYSVTRPEPT*T 19 +DP S + + + +P P T+ W DP A T W + P PT T Sbjct: 159 TDPTTWSAPTTTTTWSDQP-PPPTTTTTTVWTDPTATTTTPASTTTTTWSDLPPPPPTTT 217 >AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 23.4 bits (48), Expect = 4.9 Identities = 16/60 (26%), Positives = 23/60 (38%), Gaps = 1/60 (1%) Frame = -3 Query: 195 SDPMALSRTSVSNLFLAEPVSSPIPTSGRNWNDPLA-NR*GKEKRTRVWYSVTRPEPT*T 19 +DP S + + + +P P T+ W DP A T W + P PT T Sbjct: 159 TDPTTWSAPTTTTTWSDQP-PPPTTTTTTVWTDPTATTTTPASTTTTTWSDLPPPPPTTT 217 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 22.6 bits (46), Expect = 8.5 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = -3 Query: 405 YYDYPCPLLYIVSPESGCENILGSL 331 +Y Y PL Y P + CE SL Sbjct: 3186 HYKYCMPLTYDGHPSASCEGEWSSL 3210 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 466,034 Number of Sequences: 2352 Number of extensions: 9081 Number of successful extensions: 54 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 54 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 54 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 49474503 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -