Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NRPG0382
         (533 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g33060.1 68415.m04054 leucine-rich repeat family protein cont...    27   5.9  

>At2g33060.1 68415.m04054 leucine-rich repeat family protein
           contains leucine rich-repeat domains Pfam:PF00560,
           INTERPRO:IPR001611; contains similarity to Hcr2-0B
           [Lycopersicon esculentum] gi|3894387|gb|AAC78593
          Length = 808

 Score = 27.5 bits (58), Expect = 5.9
 Identities = 19/67 (28%), Positives = 31/67 (46%), Gaps = 3/67 (4%)
 Frame = +2

Query: 71  SFPYLFARGSFQLRPDVGIGELTGSARNKLLTLVLERAIGSESCPIDN---YWRETQWAL 241
           S P +F+ G+     DVG  +LTG     LL   + R +  +   I +   +W +    L
Sbjct: 449 SLPDIFSDGALLRTLDVGYNQLTGKLPRSLLNCSMLRFVSVDHNKIKDTFPFWLKALPDL 508

Query: 242 A*VTIRS 262
             +T+RS
Sbjct: 509 QALTLRS 515


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 9,737,086
Number of Sequences: 28952
Number of extensions: 186989
Number of successful extensions: 384
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 373
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 384
length of database: 12,070,560
effective HSP length: 77
effective length of database: 9,841,256
effective search space used: 984125600
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)