BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0380 (708 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC365.08c |||Der1-like |Schizosaccharomyces pombe|chr 2|||Manual 27 2.6 SPAC3A12.05c |taf2||TATA-binding protein associated factor Taf2|... 25 8.0 >SPBC365.08c |||Der1-like |Schizosaccharomyces pombe|chr 2|||Manual Length = 224 Score = 27.1 bits (57), Expect = 2.6 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = +2 Query: 443 LLNKYTNLSTAFLLHTSLFTVYQYVTYYRNFILS 544 L Y T F +++ YQY TY NF+ + Sbjct: 60 LFTNYLYAGTGFDFIMNIYFFYQYSTYLENFVFA 93 >SPAC3A12.05c |taf2||TATA-binding protein associated factor Taf2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1174 Score = 25.4 bits (53), Expect = 8.0 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = -2 Query: 653 IKNPKSCTLCRRDTEFVCYALYSQCSRL 570 I NPKS L +R+ +C LY S L Sbjct: 1072 INNPKSDLLTKRNLLMICRVLYKAKSSL 1099 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,682,144 Number of Sequences: 5004 Number of extensions: 52312 Number of successful extensions: 107 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 103 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 107 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 329179816 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -