BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0380 (708 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization prot... 23 2.1 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 21 8.7 AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropi... 21 8.7 >DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization protein protein. Length = 250 Score = 23.4 bits (48), Expect = 2.1 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -3 Query: 64 RLRKNYVHKHRFSYEQRLI 8 R RK+ VHK + S EQR + Sbjct: 103 RERKHAVHKEQLSREQRFL 121 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/31 (25%), Positives = 17/31 (54%) Frame = +2 Query: 452 KYTNLSTAFLLHTSLFTVYQYVTYYRNFILS 544 KY+N + + + + Y YY+N+I++ Sbjct: 323 KYSNYNNYNNYNNNNYNNYNKKLYYKNYIIN 353 >AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropin releasing hormone-binding protein protein. Length = 332 Score = 21.4 bits (43), Expect = 8.7 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 407 DYGKHIYCTYCSL 445 +YG+ I CTY +L Sbjct: 210 NYGRRINCTYVAL 222 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 176,838 Number of Sequences: 438 Number of extensions: 3451 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21804885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -