BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0378 (651 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g61980.1 68416.m06961 serine protease inhibitor, Kazal-type f... 36 0.031 At4g01575.1 68417.m00205 serine protease inhibitor, Kazal-type f... 34 0.071 At3g46870.1 68416.m05087 pentatricopeptide (PPR) repeat-containi... 30 1.2 At1g77300.1 68414.m09002 SET domain-containing protein similar t... 28 4.7 At1g20450.2 68414.m02549 dehydrin (ERD10) identical to dehydrin ... 28 6.2 At1g20450.1 68414.m02548 dehydrin (ERD10) identical to dehydrin ... 28 6.2 >At3g61980.1 68416.m06961 serine protease inhibitor, Kazal-type family protein contains Pfam domain PF00050: Kazal-type serine protease inhibitor domain Length = 117 Score = 35.5 bits (78), Expect = 0.031 Identities = 22/46 (47%), Positives = 24/46 (52%) Frame = +1 Query: 100 CYRNQRPVCGTDGKTYNNECLLDCATRDDPGLRVRYQGPCSEGNVG 237 C+R PVCGTDG TY C D A G RV +G C GN G Sbjct: 48 CFRAD-PVCGTDGVTYWCGC-PDAACH---GARVVKKGACDTGNAG 88 >At4g01575.1 68417.m00205 serine protease inhibitor, Kazal-type family protein contains Pfam domain PF00050: Kazal-type serine protease inhibitor domain Length = 144 Score = 34.3 bits (75), Expect = 0.071 Identities = 23/54 (42%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Frame = +1 Query: 76 LAYPPSCA--CYRNQRPVCGTDGKTYNNECLLDCATRDDPGLRVRYQGPCSEGN 231 +A P SC C+R PVCG D TY CA G+RV QG C GN Sbjct: 65 IAKPASCPVQCFRPD-PVCGEDSVTY----WCGCADALCHGVRVVKQGACDVGN 113 >At3g46870.1 68416.m05087 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 257 Score = 30.3 bits (65), Expect = 1.2 Identities = 16/42 (38%), Positives = 24/42 (57%) Frame = -3 Query: 520 PSLESLIVAQFKRQSLLYVIPSLPQTGFISRVHVHEGYLLGP 395 PS+ + + K ++LL+ IP P T F+SR H+G GP Sbjct: 26 PSIHRISFSNLKPKTLLHPIPPKPFTVFVSR--FHDGRPRGP 65 >At1g77300.1 68414.m09002 SET domain-containing protein similar to huntingtin interacting protein 1 [Homo sapiens] GI:12697196; contains Pfam profile PF00856: SET domain Length = 1759 Score = 28.3 bits (60), Expect = 4.7 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = +3 Query: 360 SGLCADEVKIVDGPSKYPSCTCTREMKP-VCGSDGITYNND 479 SG+ + + D P ++ S T+ +KP SDGI+Y D Sbjct: 177 SGIDTESTFVNDAPEQFESLETTKHIKPDEVESDGISYRFD 217 >At1g20450.2 68414.m02549 dehydrin (ERD10) identical to dehydrin ERD10 (Low-temperature-induced protein LTI45) [Arabidopsis thaliana] SWISS-PROT:P42759 Length = 259 Score = 27.9 bits (59), Expect = 6.2 Identities = 11/29 (37%), Positives = 21/29 (72%) Frame = +2 Query: 551 GYSRRPWDARGLPRNTTPVIELHTPLVQV 637 G+S++P D++ + NTTP++E TP+ + Sbjct: 199 GHSKKPEDSQVV--NTTPLVETATPIADI 225 >At1g20450.1 68414.m02548 dehydrin (ERD10) identical to dehydrin ERD10 (Low-temperature-induced protein LTI45) [Arabidopsis thaliana] SWISS-PROT:P42759 Length = 260 Score = 27.9 bits (59), Expect = 6.2 Identities = 11/29 (37%), Positives = 21/29 (72%) Frame = +2 Query: 551 GYSRRPWDARGLPRNTTPVIELHTPLVQV 637 G+S++P D++ + NTTP++E TP+ + Sbjct: 200 GHSKKPEDSQVV--NTTPLVETATPIADI 226 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,889,517 Number of Sequences: 28952 Number of extensions: 288552 Number of successful extensions: 712 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 691 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 711 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1354097952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -