Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NRPG0377
         (643 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

05_03_0179 - 9257066-9258946                                           28   7.2  

>05_03_0179 - 9257066-9258946
          Length = 626

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 13/40 (32%), Positives = 21/40 (52%), Gaps = 1/40 (2%)
 Frame = +2

Query: 68  TETDSSRTCKQTDVSQPW-QSRGVIISCITCYLNTARGSQ 184
           TE +S  T +QT  + PW   + + +  +TCY    R S+
Sbjct: 320 TEVNSKFTLRQTSFNNPWFGHQAISVVYLTCYSCLDRSSE 359


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,950,125
Number of Sequences: 37544
Number of extensions: 245584
Number of successful extensions: 380
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 370
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 380
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1584867848
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)