BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0377 (643 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57166| Best HMM Match : 7tm_1 (HMM E-Value=2.2e-25) 29 2.4 SB_39575| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_30851| Best HMM Match : C2 (HMM E-Value=0.0042) 28 5.6 >SB_57166| Best HMM Match : 7tm_1 (HMM E-Value=2.2e-25) Length = 382 Score = 29.5 bits (63), Expect = 2.4 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 115 ALAKSWCYNFMHYLLPQYGTWKSST*TH 198 ALA WC N ++Y L +G W+ + H Sbjct: 265 ALAVCWCPNQVYYALYNFGAWELNNNVH 292 >SB_39575| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 770 Score = 28.7 bits (61), Expect = 4.2 Identities = 16/46 (34%), Positives = 23/46 (50%) Frame = +2 Query: 134 VIISCITCYLNTARGSQAREHMMNEVFIVAC*RRSTSGLLKKALAF 271 V +SC Y+NTAR AR+ + E + +A G + A AF Sbjct: 206 VHVSCACAYINTAREVCARKVCVRETYSMASIAILVGGAVLNATAF 251 >SB_30851| Best HMM Match : C2 (HMM E-Value=0.0042) Length = 889 Score = 28.3 bits (60), Expect = 5.6 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +2 Query: 71 ETDSSRTCKQTDVSQPW 121 +TD +TC QTD SQ W Sbjct: 125 QTDDGQTCNQTDDSQTW 141 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,118,940 Number of Sequences: 59808 Number of extensions: 316206 Number of successful extensions: 637 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 591 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 637 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1620947750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -