BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0371 (672 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 26 1.2 AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase ... 25 1.6 AY062189-1|AAL58550.1| 151|Anopheles gambiae cytochrome P450 CY... 25 2.9 AY062200-1|AAL58561.1| 151|Anopheles gambiae cytochrome P450 CY... 24 3.8 AF487534-1|AAL93295.1| 509|Anopheles gambiae cytochrome P450 CY... 23 6.6 X98186-1|CAA66861.1| 269|Anopheles gambiae put. S3a ribosomal p... 23 8.8 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 25.8 bits (54), Expect = 1.2 Identities = 14/53 (26%), Positives = 23/53 (43%) Frame = -1 Query: 348 GSSSKDVTNNSWSQATPSAMKYLNNTLLYTPRTSSSTTKMLPAGIPPPTIWSK 190 GSSS ++ S +PS + + P + + P G+P PT+ K Sbjct: 755 GSSSTASSSVSTGMPSPSRSAFADGIGSPPPPPPPPPSSLSPGGVPRPTVLQK 807 >AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase protein. Length = 849 Score = 25.4 bits (53), Expect = 1.6 Identities = 12/50 (24%), Positives = 24/50 (48%) Frame = -1 Query: 345 SSSKDVTNNSWSQATPSAMKYLNNTLLYTPRTSSSTTKMLPAGIPPPTIW 196 S S ++ ++WS ++ N L P ++ T++ P G+ P +W Sbjct: 472 SKSMNIFGSAWSVNYNTSTVMTNKDLTLNPGSTDYDTEIYPIGLDP--VW 519 >AY062189-1|AAL58550.1| 151|Anopheles gambiae cytochrome P450 CYP4G16 protein. Length = 151 Score = 24.6 bits (51), Expect = 2.9 Identities = 10/27 (37%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = -1 Query: 213 PPPTIWSKDG-IPEDTYGRLFFTFVPF 136 P P +++ D +PE R ++ FVPF Sbjct: 115 PNPDVFNPDNFLPEKQANRHYYAFVPF 141 >AY062200-1|AAL58561.1| 151|Anopheles gambiae cytochrome P450 CYP4G17 protein. Length = 151 Score = 24.2 bits (50), Expect = 3.8 Identities = 9/27 (33%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = -1 Query: 213 PPPTIWSKDG-IPEDTYGRLFFTFVPF 136 P P ++ D +PE T R +++++PF Sbjct: 115 PHPETFNPDNFLPERTQNRHYYSYIPF 141 >AF487534-1|AAL93295.1| 509|Anopheles gambiae cytochrome P450 CYP6P3 protein. Length = 509 Score = 23.4 bits (48), Expect = 6.6 Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = -1 Query: 225 PAGIPPPTIWSKDG-IPEDTYGRLFFTFVPF 136 P P P ++ D +PE+ R FTF+PF Sbjct: 417 PDHYPDPERFNPDRFLPEEVKKRHPFTFIPF 447 >X98186-1|CAA66861.1| 269|Anopheles gambiae put. S3a ribosomal protein homologue protein. Length = 269 Score = 23.0 bits (47), Expect = 8.8 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +2 Query: 98 RSFRKFIDISTHINGTKVKNN 160 RSFRKF ++ +NG V N Sbjct: 82 RSFRKFKLVAESVNGRDVLTN 102 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 742,520 Number of Sequences: 2352 Number of extensions: 16796 Number of successful extensions: 54 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 52 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 54 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67322955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -