BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0371 (672 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g11220.1 68416.m01364 Paxneb protein-related contains Pfam pr... 74 8e-14 At2g45340.1 68415.m05642 leucine-rich repeat transmembrane prote... 30 1.2 At3g59490.1 68416.m06638 expressed protein 29 2.8 At2g41420.1 68415.m05111 proline-rich family protein contains pr... 28 4.9 At2g22680.1 68415.m02688 zinc finger (C3HC4-type RING finger) fa... 28 4.9 At1g78310.1 68414.m09126 VQ motif-containing protein contains PF... 28 4.9 At5g51460.3 68418.m06381 trehalose-6-phosphate phosphatase (TPPA... 28 6.5 At5g51460.2 68418.m06380 trehalose-6-phosphate phosphatase (TPPA... 28 6.5 At5g51460.1 68418.m06379 trehalose-6-phosphate phosphatase (TPPA... 28 6.5 At4g35800.1 68417.m05087 DNA-directed RNA polymerase II largest ... 28 6.5 At1g80930.1 68414.m09495 MIF4G domain-containing protein / MA3 d... 28 6.5 At4g20860.1 68417.m03026 FAD-binding domain-containing protein s... 27 8.6 At1g20970.1 68414.m02625 adhesin-related contains TIGRFAM TIGR01... 27 8.6 >At3g11220.1 68416.m01364 Paxneb protein-related contains Pfam profile PF05625: PAXNEB protein; similar to Paxneb protein (GI:10129788) [Mus musculus]; similar to PAX neighbour protein (GI:15887001) [Takifugu rubripes] Length = 355 Score = 74.1 bits (174), Expect = 8e-14 Identities = 44/148 (29%), Positives = 76/148 (51%), Gaps = 4/148 (2%) Frame = +2 Query: 101 SFRKFIDI--STHINGTKV-KNNLPYVSSGIPSLDHIVGGGIPAGSIFVVEEDVLGVYSK 271 SF + I + S I G K N ++SSGI LD I+GGG P GS+ +V ED + Sbjct: 11 SFSRNISVVSSPQIPGLKSGPNGTAFISSGIRDLDRILGGGYPLGSLVMVMEDPEAPHHM 70 Query: 272 VLFKYFIAEGVACDHELFVTSLDEDPHKITSELPQPCALPPEDEKAPSTD-AEKMKIAWR 448 L + ++++G+ + L S +DP LP P + + AP D E ++IAW+ Sbjct: 71 DLLRTYMSQGLVNNQPLLYASPSKDPKGFLGTLPHPASSKEDKPTAPDPDQGESLRIAWQ 130 Query: 449 YEGLSQVESSFGSNTNFGHNFDLSRYID 532 Y +E+ + ++ ++FD+ + ++ Sbjct: 131 YR--KYLENQKNAIDDYSNDFDMRKPLE 156 >At2g45340.1 68415.m05642 leucine-rich repeat transmembrane protein kinase, putative Length = 691 Score = 30.3 bits (65), Expect = 1.2 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -1 Query: 333 DVTNNSWSQATPSAMKYLNNTLLYT 259 D+ NNS+S PSA+K LNN Y+ Sbjct: 218 DIRNNSFSGFVPSALKRLNNGFQYS 242 >At3g59490.1 68416.m06638 expressed protein Length = 243 Score = 29.1 bits (62), Expect = 2.8 Identities = 17/72 (23%), Positives = 39/72 (54%), Gaps = 3/72 (4%) Frame = +2 Query: 161 LPYVSSGIPSLDHIVGGGIPAGS---IFVVEEDVLGVYSKVLFKYFIAEGVACDHELFVT 331 +P + + + SL ++ G+P + V+E+ + + + L K F++ + + ELF Sbjct: 55 MPELQNRLLSLLELIREGLPVFKDLKVMVIEDMIYLINVRSLPK-FVSSSLDSEPELFFI 113 Query: 332 SLDEDPHKITSE 367 L++DP K+ ++ Sbjct: 114 DLEQDPPKMVTQ 125 >At2g41420.1 68415.m05111 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 98 Score = 28.3 bits (60), Expect = 4.9 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -1 Query: 225 PAGIPPPTIWSKDGIPEDTY 166 P G+PPP + +G P+D Y Sbjct: 8 PVGVPPPQGYPPEGYPKDAY 27 >At2g22680.1 68415.m02688 zinc finger (C3HC4-type RING finger) family protein contains Pfam profiles PF00097: Zinc finger, C3HC4 type (RING finger), PF00092: von Willebrand factor type A domain Length = 683 Score = 28.3 bits (60), Expect = 4.9 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -1 Query: 261 TPRTSSSTTKMLPAGIPPPTIWSKDGIPEDTYGR 160 T R + ++ + IP TIW IPED + R Sbjct: 418 TDRQAHQVAQLAHSRIPIHTIWLSHAIPEDAFAR 451 >At1g78310.1 68414.m09126 VQ motif-containing protein contains PF05678: VQ motif Length = 311 Score = 28.3 bits (60), Expect = 4.9 Identities = 15/55 (27%), Positives = 26/55 (47%), Gaps = 2/55 (3%) Frame = -1 Query: 315 WSQATPSAMKYLNNTLL--YTPRTSSSTTKMLPAGIPPPTIWSKDGIPEDTYGRL 157 W Q +A +N+ + P SS+ ++ +P IP P ++ P+ YG L Sbjct: 225 WYQQQENAPPSQHNSFPPPHPPPPSSAVSQTVPTSIPAPPLFGCSSSPKSPYGLL 279 >At5g51460.3 68418.m06381 trehalose-6-phosphate phosphatase (TPPA) identical to trehalose-6-phosphate phosphatase (AtTPPA) [Arabidopsis thaliana] GI:2944178 Length = 385 Score = 27.9 bits (59), Expect = 6.5 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 9/57 (15%) Frame = -1 Query: 315 WSQATPSAMKYLNNTLLYTPRT---------SSSTTKMLPAGIPPPTIWSKDGIPED 172 +S A +A+ NN LL PR S+ + + PPPTI +KD + D Sbjct: 32 YSSAAATAISQNNNLLLTVPRKKTGILDDVKSNGWLDAMKSSSPPPTILNKDNLSND 88 >At5g51460.2 68418.m06380 trehalose-6-phosphate phosphatase (TPPA) identical to trehalose-6-phosphate phosphatase (AtTPPA) [Arabidopsis thaliana] GI:2944178 Length = 384 Score = 27.9 bits (59), Expect = 6.5 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 9/57 (15%) Frame = -1 Query: 315 WSQATPSAMKYLNNTLLYTPRT---------SSSTTKMLPAGIPPPTIWSKDGIPED 172 +S A +A+ NN LL PR S+ + + PPPTI +KD + D Sbjct: 32 YSSAAATAISQNNNLLLTVPRKKTGILDDVKSNGWLDAMKSSSPPPTILNKDNLSND 88 >At5g51460.1 68418.m06379 trehalose-6-phosphate phosphatase (TPPA) identical to trehalose-6-phosphate phosphatase (AtTPPA) [Arabidopsis thaliana] GI:2944178 Length = 385 Score = 27.9 bits (59), Expect = 6.5 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 9/57 (15%) Frame = -1 Query: 315 WSQATPSAMKYLNNTLLYTPRT---------SSSTTKMLPAGIPPPTIWSKDGIPED 172 +S A +A+ NN LL PR S+ + + PPPTI +KD + D Sbjct: 32 YSSAAATAISQNNNLLLTVPRKKTGILDDVKSNGWLDAMKSSSPPPTILNKDNLSND 88 >At4g35800.1 68417.m05087 DNA-directed RNA polymerase II largest subunit (RPB205) (RPII) (RPB1) nearly identical to P|P18616 DNA-directed RNA polymerase II largest subunit (EC 2.7.7.6) {Arabidopsis thaliana} Length = 1840 Score = 27.9 bits (59), Expect = 6.5 Identities = 17/49 (34%), Positives = 25/49 (51%) Frame = -2 Query: 647 CETKHFLISLCA*SFASLKYCLAKL*YHTGFYSFLLCQHQCICSSQSYV 501 CET ++ C F L+ LAK YH GF +L +C+C + S + Sbjct: 66 CETCMANMAECPGHFGYLE--LAKPMYHVGFMKTVLSIMRCVCFNCSKI 112 >At1g80930.1 68414.m09495 MIF4G domain-containing protein / MA3 domain-containing protein similar to SP|Q9P6R9 Cell cycle control protein cwf22 {Schizosaccharomyces pombe}; contains Pfam profiles PF02854: MIF4G domain, PF02847: MA3 domain Length = 900 Score = 27.9 bits (59), Expect = 6.5 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +1 Query: 568 YYNLARQYFKLANDYAQREIKKCFVSQ 648 YY L Q F + N Q +KCFV Q Sbjct: 701 YYGLLGQRFCMINKIHQENFEKCFVQQ 727 >At4g20860.1 68417.m03026 FAD-binding domain-containing protein simlar to SP|P30986 reticuline oxidase precursor (Berberine-bridge-forming enzyme) (BBE) (Tetrahydroprotoberberine synthase) [Eschscholzia californica]; contains PF01565 FAD binding domain Length = 530 Score = 27.5 bits (58), Expect = 8.6 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = +1 Query: 586 QYFKLANDYAQREIKKCFVSQIAKKYL 666 QYFK +DY Q+ + + ++ K++L Sbjct: 369 QYFKAKSDYVQKPVPENVFEEVTKRFL 395 >At1g20970.1 68414.m02625 adhesin-related contains TIGRFAM TIGR01612: reticulocyte binding protein; contains TIGRFAM TIGR00864: polycystin cation channel protein; similar to fimbriae-associated protein Fap1 [Streptococcus parasanguinis] (GI:3929312) Length = 1498 Score = 27.5 bits (58), Expect = 8.6 Identities = 16/54 (29%), Positives = 28/54 (51%) Frame = +2 Query: 317 ELFVTSLDEDPHKITSELPQPCALPPEDEKAPSTDAEKMKIAWRYEGLSQVESS 478 E T +E+P K+T E + + E+EK +A KMK R E +++ + + Sbjct: 1198 EKSATPEEEEPPKLTKEEEE--LIKKEEEKRKQKEAAKMKEQHRLEEIAKAKEA 1249 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,962,911 Number of Sequences: 28952 Number of extensions: 328120 Number of successful extensions: 1056 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 1013 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1056 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1422784080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -