BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0365 (611 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ370041-1|ABD18602.1| 85|Anopheles gambiae putative salivary ... 44 3e-06 DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domai... 38 3e-04 DQ370040-1|ABD18601.1| 121|Anopheles gambiae putative TIL domai... 35 0.002 DQ370039-1|ABD18600.1| 168|Anopheles gambiae putative TIL domai... 33 0.005 DQ370037-1|ABD18598.1| 121|Anopheles gambiae putative TIL domai... 33 0.005 DQ370047-1|ABD18608.1| 89|Anopheles gambiae putative secreted ... 27 0.48 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 25 1.9 AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical prot... 25 1.9 AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein pr... 25 2.5 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 24 3.4 AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase... 24 3.4 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 24 4.4 AJ000675-1|CAA04232.1| 600|Anopheles gambiae infection responsi... 24 4.4 L76038-1|AAC27383.1| 683|Anopheles gambiae prophenoloxidase pro... 23 5.9 AF031626-1|AAD01936.1| 683|Anopheles gambiae prophenoloxidase p... 23 5.9 DQ370042-1|ABD18603.1| 194|Anopheles gambiae putative TIL domai... 23 7.8 >DQ370041-1|ABD18602.1| 85|Anopheles gambiae putative salivary secreted peptide withTIL domain protein. Length = 85 Score = 44.4 bits (100), Expect = 3e-06 Identities = 22/58 (37%), Positives = 28/58 (48%), Gaps = 2/58 (3%) Frame = +1 Query: 61 KDCPENSHLTM--NPCAPTCEDPDLTHTSCVAALLPTCHCDDGFLFDKSGKCVPVDEC 228 K C EN C TC++ D C AA + C C DGFL +++GKCV C Sbjct: 24 KKCGENEIYQRCGTGCERTCDNGDTWDKPCKAACVDKCFCKDGFLRNENGKCVRAWHC 81 >DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domain protein protein. Length = 285 Score = 37.9 bits (84), Expect = 3e-04 Identities = 22/66 (33%), Positives = 32/66 (48%), Gaps = 2/66 (3%) Frame = +1 Query: 31 GSRSQPGSVEKDCPENSHLTMNPCAPTCEDPDLTHT-SCVAALLPTCHCDDGFLFD-KSG 204 GS V + CP+N + CAP + ++ C + LP C C GF+ + + G Sbjct: 14 GSLEASRCVHRRCPKNE--VYSCCAPCPQKACISEAVKCQTSCLPGCVCKKGFVRETQFG 71 Query: 205 KCVPVD 222 CVPVD Sbjct: 72 NCVPVD 77 Score = 34.3 bits (75), Expect = 0.003 Identities = 16/45 (35%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = +1 Query: 100 CAPTCEDPDLTHTSCVAALLPTCHCDDGFL-FDKSGKCVPVDECP 231 C P + T T C A C C GF+ + GKC+P+ CP Sbjct: 73 CVPVDTTYNPTTTKCAAGFTSGCVCKKGFVRKTEFGKCIPLRLCP 117 >DQ370040-1|ABD18601.1| 121|Anopheles gambiae putative TIL domain polypeptide protein. Length = 121 Score = 34.7 bits (76), Expect = 0.002 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 5/48 (10%) Frame = +1 Query: 100 CAPTCEDPDLTH-----TSCVAALLPTCHCDDGFLFDKSGKCVPVDEC 228 C P C D T+ ++C + P C C G++ +KS +CVP C Sbjct: 70 CGPACGDRTCTNQRKNDSACRRSCNPGCFCRGGYVRNKSNRCVPSYMC 117 >DQ370039-1|ABD18600.1| 168|Anopheles gambiae putative TIL domain polypeptide protein. Length = 168 Score = 33.5 bits (73), Expect = 0.005 Identities = 14/40 (35%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = +1 Query: 100 CAPTCEDPDLTHTSCVAALLPTCHCDDGFLFD-KSGKCVP 216 C TC D + C + C C GF+ + K GKC+P Sbjct: 48 CPNTCADLNELQKPCTKQCIQGCFCKPGFVRESKEGKCIP 87 >DQ370037-1|ABD18598.1| 121|Anopheles gambiae putative TIL domain polypeptide protein. Length = 121 Score = 33.5 bits (73), Expect = 0.005 Identities = 18/69 (26%), Positives = 29/69 (42%), Gaps = 6/69 (8%) Frame = +1 Query: 40 SQPGSVEKDCPENSHLTMNPCAPTCEDPDLT------HTSCVAALLPTCHCDDGFLFDKS 201 S P +E P + N C +C+D H +C + C C +G++ DK Sbjct: 51 SPPPKIECTDPREVY---NECGSSCDDRTCENIRRGDHLACTKHCVEGCFCRNGYVRDKY 107 Query: 202 GKCVPVDEC 228 +C+P C Sbjct: 108 DRCIPSYRC 116 >DQ370047-1|ABD18608.1| 89|Anopheles gambiae putative secreted peptide protein. Length = 89 Score = 27.1 bits (57), Expect = 0.48 Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 7/55 (12%) Frame = +1 Query: 100 CAPTCED--PDLTHTSCVAALLPT---CHCDDGFLFD-KSGKCVPVDEC-PDQES 243 C P E+ D +C + +P C C G+ D SGKC+ D+C P ES Sbjct: 28 CDPIYEEFTDDGCDDNCQGSCIPMKDFCACRIGYKRDLTSGKCIAADQCTPVPES 82 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 25.0 bits (52), Expect = 1.9 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -1 Query: 293 SRAKPLPIISRNQLIQSLSWSGHSSTGTHFPDL 195 S A P I+SR + + + S +S GT PDL Sbjct: 531 SSAPPSSIVSRRRFFNTSASSSVTSEGTITPDL 563 >AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical protein protein. Length = 765 Score = 25.0 bits (52), Expect = 1.9 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -1 Query: 293 SRAKPLPIISRNQLIQSLSWSGHSSTGTHFPDL 195 S A P I+SR + + + S +S GT PDL Sbjct: 532 SSAPPSSIVSRRRFFNTSASSSVTSEGTITPDL 564 >AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein protein. Length = 476 Score = 24.6 bits (51), Expect = 2.5 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +1 Query: 43 QPGSVEKDCPENSHLTMNPCAPTCEDPDLTHTSC 144 +PG +++DCP S+ T P + T D + +C Sbjct: 209 KPGHMKRDCPMESNNT--PTSTTMRDYSRKNENC 240 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 24.2 bits (50), Expect = 3.4 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 502 FVWRGEELNAPC 537 FVWRG+E PC Sbjct: 1606 FVWRGKECYLPC 1617 >AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase subunit 1 protein. Length = 688 Score = 24.2 bits (50), Expect = 3.4 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +1 Query: 175 DDGFLFDKSGKCVPVDE 225 D GF+ DKSG + +DE Sbjct: 321 DQGFVLDKSGNRIMLDE 337 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 23.8 bits (49), Expect = 4.4 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -2 Query: 577 KSKFPSRKRLNQNRTVRSTP 518 +SK P+ L+QN T RSTP Sbjct: 468 RSKTPNSIYLSQNGTPRSTP 487 Score = 23.4 bits (48), Expect = 5.9 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = -3 Query: 540 IARCVQLLPSPNELPFEK 487 + RC Q++P+ N+ +EK Sbjct: 311 LVRCYQIIPNNNKATYEK 328 >AJ000675-1|CAA04232.1| 600|Anopheles gambiae infection responsive serine proteaselike protein protein. Length = 600 Score = 23.8 bits (49), Expect = 4.4 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +1 Query: 193 DKSGKCVPVDECPDQE 240 +++G C ECPDQE Sbjct: 35 NRAGYCTTKAECPDQE 50 >L76038-1|AAC27383.1| 683|Anopheles gambiae prophenoloxidase protein. Length = 683 Score = 23.4 bits (48), Expect = 5.9 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +1 Query: 181 GFLFDKSGKCVPVDE 225 GF+ D+SG +P+DE Sbjct: 323 GFVVDESGNRIPLDE 337 >AF031626-1|AAD01936.1| 683|Anopheles gambiae prophenoloxidase protein. Length = 683 Score = 23.4 bits (48), Expect = 5.9 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +1 Query: 181 GFLFDKSGKCVPVDE 225 GF+ D+SG +P+DE Sbjct: 323 GFVVDESGNRIPLDE 337 >DQ370042-1|ABD18603.1| 194|Anopheles gambiae putative TIL domain polypeptide protein. Length = 194 Score = 23.0 bits (47), Expect = 7.8 Identities = 7/23 (30%), Positives = 11/23 (47%), Gaps = 1/23 (4%) Frame = +1 Query: 166 CHCDDGFLFDKSG-KCVPVDECP 231 C C ++ G C+P + CP Sbjct: 172 CFCKPSYIRSSDGGPCIPTNNCP 194 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 691,304 Number of Sequences: 2352 Number of extensions: 14179 Number of successful extensions: 57 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 49 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 55 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 59711994 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -