BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0358 (704 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 25 0.53 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 25 0.92 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 25 0.92 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 25 0.92 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 25 0.92 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 25 0.92 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 25 0.92 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 25 0.92 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 25 0.92 AB013287-1|BAA87893.1| 190|Apis mellifera calmodulin kinase II ... 24 1.2 AF487333-1|AAL93262.1| 80|Apis mellifera integrin betaPS protein. 23 2.8 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 22 4.9 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 22 6.5 DQ855487-1|ABH88174.1| 125|Apis mellifera chemosensory protein ... 21 8.6 AJ973402-1|CAJ01449.1| 125|Apis mellifera hypothetical protein ... 21 8.6 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 25.4 bits (53), Expect = 0.53 Identities = 18/42 (42%), Positives = 23/42 (54%), Gaps = 3/42 (7%) Frame = -1 Query: 434 SPADRGDNAGPSDRDSDIFRTLPPT---LNPAFSADSEARRD 318 SP+DRG N SDR T PPT ++ A S D ++ RD Sbjct: 1380 SPSDRGRNDDGSDR-----LTSPPTPLSISRAGSRDEDSTRD 1416 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 24.6 bits (51), Expect = 0.92 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +1 Query: 559 AREEKFHSRARAESPERHSRCGA 627 ARE+K R+++ SPE R A Sbjct: 68 AREKKLSKRSKSRSPESRGRSNA 90 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 24.6 bits (51), Expect = 0.92 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +1 Query: 559 AREEKFHSRARAESPERHSRCGA 627 ARE+K R+++ SPE R A Sbjct: 68 AREKKLSKRSKSRSPESRGRSNA 90 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 24.6 bits (51), Expect = 0.92 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +1 Query: 559 AREEKFHSRARAESPERHSRCGA 627 ARE+K R+++ SPE R A Sbjct: 68 AREKKLSKRSKSRSPESRGRSNA 90 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 24.6 bits (51), Expect = 0.92 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +1 Query: 559 AREEKFHSRARAESPERHSRCGA 627 ARE+K R+++ SPE R A Sbjct: 68 AREKKLSKRSKSRSPESRGRSNA 90 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 24.6 bits (51), Expect = 0.92 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +1 Query: 559 AREEKFHSRARAESPERHSRCGA 627 ARE+K R+++ SPE R A Sbjct: 68 AREKKLSKRSKSRSPESRGRSNA 90 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 24.6 bits (51), Expect = 0.92 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +1 Query: 559 AREEKFHSRARAESPERHSRCGA 627 ARE+K R+++ SPE R A Sbjct: 68 AREKKLSKRSKSRSPESRGRSNA 90 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 24.6 bits (51), Expect = 0.92 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +1 Query: 559 AREEKFHSRARAESPERHSRCGA 627 ARE+K R+++ SPE R A Sbjct: 68 AREKKLSKRSKSRSPESRGRSNA 90 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 24.6 bits (51), Expect = 0.92 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +1 Query: 559 AREEKFHSRARAESPERHSRCGA 627 ARE+K R+++ SPE R A Sbjct: 68 AREKKLSKRSKSRSPESRGRSNA 90 >AB013287-1|BAA87893.1| 190|Apis mellifera calmodulin kinase II protein. Length = 190 Score = 24.2 bits (50), Expect = 1.2 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -2 Query: 547 DYPNPCWGCLAPHAARLASE 488 DYP+P W + P A L ++ Sbjct: 130 DYPSPEWDTVTPEAKNLINQ 149 >AF487333-1|AAL93262.1| 80|Apis mellifera integrin betaPS protein. Length = 80 Score = 23.0 bits (47), Expect = 2.8 Identities = 10/33 (30%), Positives = 14/33 (42%) Frame = -2 Query: 556 LPADYPNPCWGCLAPHAARLASEARDSTTTSAS 458 +P PC GC AP+ + T+ AS Sbjct: 12 MPKSLKEPCDGCAAPYGYKNIMTLSQDTSHFAS 44 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 22.2 bits (45), Expect = 4.9 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +3 Query: 201 STEAISLKTFQQKSHR 248 S E ISL T QQK H+ Sbjct: 224 SDEDISLTTHQQKRHK 239 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 21.8 bits (44), Expect = 6.5 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = -2 Query: 49 YCVSCGFH 26 YCV+CG H Sbjct: 542 YCVACGLH 549 >DQ855487-1|ABH88174.1| 125|Apis mellifera chemosensory protein 6 protein. Length = 125 Score = 21.4 bits (43), Expect = 8.6 Identities = 10/28 (35%), Positives = 12/28 (42%) Frame = +2 Query: 347 RRGSTWEAGCGKYRSHGPKARRCHHDRQ 430 +R WE KY S G +R H Q Sbjct: 93 KRPKDWERLSAKYDSTGEYKKRYEHGLQ 120 >AJ973402-1|CAJ01449.1| 125|Apis mellifera hypothetical protein protein. Length = 125 Score = 21.4 bits (43), Expect = 8.6 Identities = 10/28 (35%), Positives = 12/28 (42%) Frame = +2 Query: 347 RRGSTWEAGCGKYRSHGPKARRCHHDRQ 430 +R WE KY S G +R H Q Sbjct: 93 KRPKDWERLSAKYDSTGEYKKRYEHGLQ 120 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,131 Number of Sequences: 438 Number of extensions: 3414 Number of successful extensions: 19 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21683070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -