BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0353 (685 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A4CNN3 Cluster: Putative uncharacterized protein; n=1; ... 34 3.7 UniRef50_Q1JQ55 Cluster: Zgc:136271; n=10; Euteleostomi|Rep: Zgc... 33 4.9 >UniRef50_A4CNN3 Cluster: Putative uncharacterized protein; n=1; Robiginitalea biformata HTCC2501|Rep: Putative uncharacterized protein - Robiginitalea biformata HTCC2501 Length = 209 Score = 33.9 bits (74), Expect = 3.7 Identities = 19/71 (26%), Positives = 35/71 (49%) Frame = +2 Query: 41 VDA*VLPTDTAVCVLIVVLWCTPVRLLVNNIFKQNDCVTEALKICFYHFSWKFVQIILCA 220 VD ++ +T V + +++ + P++ LVN+ Q E L F +S F I LC Sbjct: 72 VDNWIIAVNT-VLLFVILYYVFPLKSLVNSFMGQERITMEGLSNLFRMYSLGFALIFLCF 130 Query: 221 VVLLSRNFVQL 253 + R++ +L Sbjct: 131 AAMYFRSYKKL 141 >UniRef50_Q1JQ55 Cluster: Zgc:136271; n=10; Euteleostomi|Rep: Zgc:136271 - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 764 Score = 33.5 bits (73), Expect = 4.9 Identities = 14/62 (22%), Positives = 32/62 (51%) Frame = +2 Query: 83 LIVVLWCTPVRLLVNNIFKQNDCVTEALKICFYHFSWKFVQIILCAVVLLSRNFVQLLLA 262 L ++L P ++ V N+ K C T L C+ F+W + + + + + + N + L++ Sbjct: 312 LSLILLMPPEQVKVRNVKKPQGCETRVLLCCYRAFNWYYYKYTVDGINVFAVNLLPLVII 371 Query: 263 SV 268 ++ Sbjct: 372 TL 373 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 647,746,338 Number of Sequences: 1657284 Number of extensions: 12681504 Number of successful extensions: 23726 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 23070 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23717 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 53305790091 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -