BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0351 (733 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value D90278-1|BAA14322.1| 177|Homo sapiens CD66d protein. 33 1.4 BC109125-1|AAI09126.1| 1037|Homo sapiens NLRP7 protein protein. 30 9.8 BC109124-1|AAI09125.1| 963|Homo sapiens NLRP7 protein protein. 30 9.8 AY154462-1|AAO18158.1| 980|Homo sapiens NALP7 protein. 30 9.8 AF464765-1|AAL69963.1| 980|Homo sapiens PYRIN-containing Apaf1-... 30 9.8 >D90278-1|BAA14322.1| 177|Homo sapiens CD66d protein. Length = 177 Score = 32.7 bits (71), Expect = 1.4 Identities = 19/39 (48%), Positives = 25/39 (64%), Gaps = 5/39 (12%) Frame = +1 Query: 313 LLNSE---HFHIY--LPFEPSLSTNNSRPKLAKSVQPFS 414 L+N E HFH+Y LP +PS+S+NNS PK K F+ Sbjct: 129 LVNEEATGHFHVYPELP-KPSISSNNSNPKEDKDAVAFT 166 >BC109125-1|AAI09126.1| 1037|Homo sapiens NLRP7 protein protein. Length = 1037 Score = 29.9 bits (64), Expect = 9.8 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +2 Query: 437 FYI*RCNAYLKYFYLSYRGLVDKKLVYLYRTMLCP 541 FY+ + N LK+ LS L+D+ + LY+TM P Sbjct: 782 FYVLKANQSLKHLRLSANVLLDEGAMLLYKTMTRP 816 >BC109124-1|AAI09125.1| 963|Homo sapiens NLRP7 protein protein. Length = 963 Score = 29.9 bits (64), Expect = 9.8 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +2 Query: 437 FYI*RCNAYLKYFYLSYRGLVDKKLVYLYRTMLCP 541 FY+ + N LK+ LS L+D+ + LY+TM P Sbjct: 782 FYVLKANQSLKHLRLSANVLLDEGAMLLYKTMTRP 816 >AY154462-1|AAO18158.1| 980|Homo sapiens NALP7 protein. Length = 980 Score = 29.9 bits (64), Expect = 9.8 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +2 Query: 437 FYI*RCNAYLKYFYLSYRGLVDKKLVYLYRTMLCP 541 FY+ + N LK+ LS L+D+ + LY+TM P Sbjct: 782 FYVLKANQSLKHLRLSANVLLDEGAMLLYKTMTRP 816 >AF464765-1|AAL69963.1| 980|Homo sapiens PYRIN-containing Apaf1-like protein 3 protein. Length = 980 Score = 29.9 bits (64), Expect = 9.8 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +2 Query: 437 FYI*RCNAYLKYFYLSYRGLVDKKLVYLYRTMLCP 541 FY+ + N LK+ LS L+D+ + LY+TM P Sbjct: 782 FYVLKANQSLKHLRLSANVLLDEGAMLLYKTMTRP 816 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 97,458,968 Number of Sequences: 237096 Number of extensions: 2002812 Number of successful extensions: 3368 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3220 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3368 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8679165170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -