BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0351 (733 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81131-3|CAB03424.1| 438|Caenorhabditis elegans Hypothetical pr... 28 7.8 AL032630-11|CAA21570.1| 296|Caenorhabditis elegans Hypothetical... 28 7.8 >Z81131-3|CAB03424.1| 438|Caenorhabditis elegans Hypothetical protein T24D1.4 protein. Length = 438 Score = 27.9 bits (59), Expect = 7.8 Identities = 16/72 (22%), Positives = 34/72 (47%) Frame = -1 Query: 424 SLISRTVEPIWLILVLNYLWKEKVQKVDKYENARNSIKITMSFSFDVSPVGSISFVCFKF 245 S+++R IW + Y + ++DK + ++KI +S +F + P +++ F Sbjct: 181 SILTRQTNIIWAAI---YAFSVIASRIDKSRSKMENLKIIISTAFSLWPFITLAIGFAMF 237 Query: 244 ILYKSIGILFID 209 I + I+ D Sbjct: 238 IYFNDFQIVLGD 249 >AL032630-11|CAA21570.1| 296|Caenorhabditis elegans Hypothetical protein Y62H9A.11 protein. Length = 296 Score = 27.9 bits (59), Expect = 7.8 Identities = 12/26 (46%), Positives = 18/26 (69%), Gaps = 2/26 (7%) Frame = +2 Query: 482 SYRGLVDKKLVYLYRTMLC--PYSNS 553 SY G++ K L++ +RT LC PY+ S Sbjct: 21 SYSGILFKLLIFYFRTYLCNMPYNKS 46 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,408,598 Number of Sequences: 27780 Number of extensions: 352579 Number of successful extensions: 808 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 793 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 808 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1714401074 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -