BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0351 (733 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 25 0.56 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 24 1.7 AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 23 2.2 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 22 5.2 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 22 6.8 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 21 9.0 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 21 9.0 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 25.4 bits (53), Expect = 0.56 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = -1 Query: 421 LISRTVEPIWLILVLNYLWKEKVQKVDKYENARNSIKITMSFSFDVSP 278 L+S V+ I L L Y+ K + Y+NA +S S +FD P Sbjct: 186 LVSLAVQAIDLANTLVYMADHKGDALIVYQNADDSFHRLTSNTFDYDP 233 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 23.8 bits (49), Expect = 1.7 Identities = 14/48 (29%), Positives = 24/48 (50%) Frame = -1 Query: 421 LISRTVEPIWLILVLNYLWKEKVQKVDKYENARNSIKITMSFSFDVSP 278 L+S V+ I + Y+ EK + + Y+N+ +S S +FD P Sbjct: 191 LVSLAVQAIDRTNTMVYIADEKGEGLIMYQNSDDSFHRLTSNTFDYDP 238 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 23.4 bits (48), Expect = 2.2 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = +3 Query: 213 INKIPMLLYKINLKQTKEIDPTGDTSKE 296 IN+ PM+ + ++ K++DP T K+ Sbjct: 72 INRSPMVDFGYDISDFKDVDPIFGTIKD 99 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 22.2 bits (45), Expect = 5.2 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = +3 Query: 624 SSFSCPSILLCHIPFLRSLPSYTYR 698 S+FS +I H+ FLR++P Y+++ Sbjct: 133 SAFSDKNI---HVSFLRTVPPYSHQ 154 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 21.8 bits (44), Expect = 6.8 Identities = 13/49 (26%), Positives = 25/49 (51%) Frame = -1 Query: 424 SLISRTVEPIWLILVLNYLWKEKVQKVDKYENARNSIKITMSFSFDVSP 278 SL+ + ++P+ I+ Y+ +K + Y+N+ S S +FD P Sbjct: 191 SLVVQAMDPVNTIV---YMADDKGDALIVYQNSDESFHRLTSNTFDYDP 236 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 21.4 bits (43), Expect = 9.0 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +1 Query: 70 VRDMSSYCKCIVKDILSFFFNYKK 141 +RD + Y + ++ILS+F YKK Sbjct: 415 MRDPAFYM--LYQNILSYFLRYKK 436 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.4 bits (43), Expect = 9.0 Identities = 8/28 (28%), Positives = 14/28 (50%) Frame = -2 Query: 129 EKERKNVFNYTFTIRRHVTYVQYNTTVN 46 + E KN+ ++ T + V TT+N Sbjct: 813 KSEEKNINDHCVTTEQSVVVTNVTTTIN 840 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 210,612 Number of Sequences: 438 Number of extensions: 5047 Number of successful extensions: 13 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22779405 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -