BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0343 (365 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 4.6 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 4.6 AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 21 6.0 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 20 8.0 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 20 8.0 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.0 bits (42), Expect = 4.6 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +3 Query: 60 NAYAVAYIKLKKKVYIVASD 119 N Y + YI+L KV VA + Sbjct: 515 NVYGLPYIRLIPKVTAVAGE 534 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.0 bits (42), Expect = 4.6 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +3 Query: 60 NAYAVAYIKLKKKVYIVASD 119 N Y + YI+L KV VA + Sbjct: 515 NVYGLPYIRLIPKVTAVAGE 534 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 20.6 bits (41), Expect = 6.0 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -1 Query: 206 NKYVYSSIFKHTKVKLNLKSARIEIPTSNVRSY 108 +KY+ S IF + + N+ +P R Y Sbjct: 153 DKYMDSGIFSRAREEANVVPEGARVPIEIPRDY 185 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 20.2 bits (40), Expect = 8.0 Identities = 8/28 (28%), Positives = 14/28 (50%) Frame = +3 Query: 129 WNLDSRAFQIQLYLCVFKNRTVYILIFL 212 W L AF+I L T+ I++++ Sbjct: 215 WTLIEHAFEISTMLFFVLPMTIIIVLYI 242 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 20.2 bits (40), Expect = 8.0 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +1 Query: 52 KLKTHMPLPT*N*KKKCTL*LRTF 123 KL HM + T KCT+ +TF Sbjct: 162 KLHRHMRIHTGERPHKCTVCSKTF 185 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 104,521 Number of Sequences: 438 Number of extensions: 2076 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 8680350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -