BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0342 (743 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0639 + 5383967-5385951,5386973-5387066,5387410-5387841,538... 30 1.7 09_02_0611 + 11235977-11236180,11236453-11236495,11237171-112372... 28 9.0 02_05_0892 - 32556432-32556545,32557132-32557175,32557262-325573... 28 9.0 >12_01_0639 + 5383967-5385951,5386973-5387066,5387410-5387841, 5387935-5388219,5388324-5388641,5388756-5388983, 5389264-5389364,5389447-5389552,5389782-5390132, 5390262-5390401,5390687-5390861,5390937-5390954 Length = 1410 Score = 30.3 bits (65), Expect = 1.7 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = -1 Query: 386 FMQRLLHSLDSCQYNITVKRAVKQRNL 306 F+Q+LLH LD C N + R +K NL Sbjct: 936 FVQQLLHGLDHCHKNGVLHRDIKGSNL 962 >09_02_0611 + 11235977-11236180,11236453-11236495,11237171-11237241, 11237637-11237865,11238277-11238611 Length = 293 Score = 27.9 bits (59), Expect = 9.0 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +1 Query: 382 IKCQDIFARKLQFPLISD*PNYQ*SLEGKW 471 ++ Q I RKL+F I+D P Q S +G+W Sbjct: 168 VETQPIERRKLEFWPINDTPGLQISKDGRW 197 >02_05_0892 - 32556432-32556545,32557132-32557175,32557262-32557319, 32560129-32560222,32560335-32560579 Length = 184 Score = 27.9 bits (59), Expect = 9.0 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 436 NHLLMGIVIYEQKYPDILCNDF 371 N+LL G + +YP +LC DF Sbjct: 163 NYLLTGWIALNTRYPSLLCPDF 184 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,546,631 Number of Sequences: 37544 Number of extensions: 297708 Number of successful extensions: 497 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 494 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 497 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1968901276 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -