BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0335 (467 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U39678-4|AAK39211.2| 330|Caenorhabditis elegans Hypothetical pr... 29 1.7 U40933-2|AAL27242.1| 158|Caenorhabditis elegans Hypothetical pr... 28 3.8 Z70780-10|CAA94827.1| 330|Caenorhabditis elegans Hypothetical p... 27 6.7 U80452-1|AAB37864.1| 270|Caenorhabditis elegans Hypothetical pr... 27 6.7 AF016687-11|ABL01528.1| 646|Caenorhabditis elegans Hypothetical... 27 8.9 >U39678-4|AAK39211.2| 330|Caenorhabditis elegans Hypothetical protein C39D10.3a protein. Length = 330 Score = 29.1 bits (62), Expect = 1.7 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 4/36 (11%) Frame = +3 Query: 204 GRLMLSERRPRMQT----DFKSAALQRVLRPIQGQP 299 GRLML ++ M+T DFKSA L L P+ +P Sbjct: 115 GRLMLVTKKHHMETDSILDFKSAILPFALDPLSNEP 150 >U40933-2|AAL27242.1| 158|Caenorhabditis elegans Hypothetical protein F20D12.7 protein. Length = 158 Score = 27.9 bits (59), Expect = 3.8 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = -3 Query: 423 EELRESFPVRLVVVEVGGRQEIMVGTFQIQ*G 328 EE+ E V LV++ +GGR +VGT ++ G Sbjct: 87 EEITEPSSVLLVMITMGGRMANVVGTMKLYKG 118 >Z70780-10|CAA94827.1| 330|Caenorhabditis elegans Hypothetical protein F46B6.11 protein. Length = 330 Score = 27.1 bits (57), Expect = 6.7 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +1 Query: 142 ASNMTVYALIVACLALGVLAEEDSCY 219 +SN+ Y ++ C+AL V A SCY Sbjct: 275 SSNLYAYMFLLRCIALDVRAHIVSCY 300 >U80452-1|AAB37864.1| 270|Caenorhabditis elegans Hypothetical protein C16C8.18 protein. Length = 270 Score = 27.1 bits (57), Expect = 6.7 Identities = 19/56 (33%), Positives = 25/56 (44%), Gaps = 1/56 (1%) Frame = +1 Query: 172 VACLALGVLAEEDSCYQNVDQGCRRTLSLPHCSAYYGQ-FKDNHVVANELKALASL 336 V C G LAEE S + +D G + L A Y Q F+ H+ +ASL Sbjct: 121 VLCSTCGRLAEESSLKKKLDYGFKFKTYLDEAIAIYDQDFELTHMRGRFCYTVASL 176 >AF016687-11|ABL01528.1| 646|Caenorhabditis elegans Hypothetical protein T21D12.7 protein. Length = 646 Score = 26.6 bits (56), Expect = 8.9 Identities = 15/58 (25%), Positives = 23/58 (39%), Gaps = 2/58 (3%) Frame = +3 Query: 153 DGVC--SHRCLSGSGCAGRGRLMLSERRPRMQTDFKSAALQRVLRPIQGQPRCSERTE 320 DG C H C+ G G G R + + R + + +R +R G C T+ Sbjct: 404 DGNCPHDHMCVQGDGSFGAARHLCCKPRKKCVIPYVDPDKKRPIRCFPGDQSCPISTD 461 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,273,717 Number of Sequences: 27780 Number of extensions: 204490 Number of successful extensions: 551 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 534 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 551 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 839684522 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -