BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0334 (679 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_1172| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 29 3.5 SB_51829| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_57023| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 >SB_1172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Frame = -1 Query: 370 RSTWPHTNILTSL*THCTSVT--ASVNCQNSHVHNTIMKRDGHDQF 239 RSTW + ++ +L V +S+NC N++ + I+ DG+DQF Sbjct: 130 RSTWVESLLVITLSRGILWVLEFSSLNCNNNNFNLNIVSVDGYDQF 175 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 29.1 bits (62), Expect = 3.5 Identities = 16/38 (42%), Positives = 23/38 (60%) Frame = -3 Query: 350 KHPHITINSLHFSNGLRKLSKFTRSQYDHETRWSRSIY 237 +H +IT H SN R+ TRS+Y+H T+W+R Y Sbjct: 571 RHEYITCG--HDSNPSRQR---TRSRYEHITKWTRPPY 603 Score = 29.1 bits (62), Expect = 3.5 Identities = 16/50 (32%), Positives = 28/50 (56%), Gaps = 3/50 (6%) Frame = -3 Query: 377 FATLDMATH---KHPHITINSLHFSNGLRKLSKFTRSQYDHETRWSRSIY 237 + TL TH ++ HIT+ + + ++K+TR Y+H T+W+R Y Sbjct: 843 YITLWTRTHHGARYEHITVWT---RSPYEHITKWTRPPYEHITKWTRPPY 889 Score = 27.9 bits (59), Expect = 8.0 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 3/50 (6%) Frame = -3 Query: 377 FATLDMATH---KHPHITINSLHFSNGLRKLSKFTRSQYDHETRWSRSIY 237 + TL TH ++ HIT+ + ++K+TR Y+H T+W+R Y Sbjct: 187 YITLWTRTHHGARYEHITVWT---RPPYEHITKWTRPPYEHITKWTRPPY 233 >SB_51829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1414 Score = 28.3 bits (60), Expect = 6.0 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = -3 Query: 179 ESDRARGDGNPDRRLERQARRGQSRHRCDIVISSVIAPRAPIS 51 E D A DG + + ++ARR + HR V+ S + P ++ Sbjct: 145 EEDAAVDDGWEGKEVRKEARRQEEEHRKVTVVHSKLHPEQSVT 187 >SB_57023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 388 Score = 27.9 bits (59), Expect = 8.0 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 3/50 (6%) Frame = -3 Query: 377 FATLDMATH---KHPHITINSLHFSNGLRKLSKFTRSQYDHETRWSRSIY 237 + TL TH ++ HIT+ + ++K+TR Y+H T+W+R Y Sbjct: 131 YITLWTRTHHGARYEHITVWT---RPPYEHITKWTRPPYEHITKWTRPPY 177 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,549,443 Number of Sequences: 59808 Number of extensions: 350744 Number of successful extensions: 997 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 879 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 992 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1745338465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -