BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0333 (536 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF283268-1|AAG15373.1| 46|Anopheles gambiae ribosomal protein ... 65 2e-12 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 26 0.70 AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 25 1.2 AY334007-1|AAR01132.1| 202|Anopheles gambiae odorant receptor 1... 24 2.8 AY334006-1|AAR01131.1| 202|Anopheles gambiae odorant receptor 1... 24 2.8 AY334005-1|AAR01130.1| 202|Anopheles gambiae odorant receptor 1... 24 2.8 U89803-1|AAD03794.1| 250|Anopheles gambiae Tc1-like transposase... 24 3.7 AY176051-1|AAO19582.1| 522|Anopheles gambiae cytochrome P450 CY... 23 4.9 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 23 4.9 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 23 4.9 AF042732-3|AAC18058.1| 496|Anopheles gambiae diphenol oxidase-A... 23 6.5 AF364130-1|AAL35506.1| 417|Anopheles gambiae putative odorant r... 23 8.6 >AF283268-1|AAG15373.1| 46|Anopheles gambiae ribosomal protein S18 protein. Length = 46 Score = 64.9 bits (151), Expect = 2e-12 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +1 Query: 346 LREDLERLKKIRAHRGMRHYWGLRVRGQH 432 LREDLERLK+I AHRGMRHYWGLRVRGQH Sbjct: 1 LREDLERLKRIHAHRGMRHYWGLRVRGQH 29 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 26.2 bits (55), Expect = 0.70 Identities = 18/75 (24%), Positives = 38/75 (50%), Gaps = 7/75 (9%) Frame = +1 Query: 31 SLVIPDKFQHILRIMNTNIDGKRKVMFAMTAIKGVG------LRYSNIVLKKADIDLDKR 192 S ++P+ F H+ R+ +++ + F+ T + G+G LR NI + +++++ Sbjct: 106 SKLLPNSFVHLARLKALSLEFCKIAKFSSTVLAGLGDLRNFTLRTHNIAWPELNLEIEAD 165 Query: 193 A-GECTEEEVEKIIT 234 A G+ EV + T Sbjct: 166 AFGQTRNLEVLDLST 180 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 25.4 bits (53), Expect = 1.2 Identities = 12/40 (30%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +1 Query: 145 YSNIVLKKADIDLDKRAGECTEEEV-EKIITIMSNPRQYK 261 Y+ IVL +A + LDK +C + + +II + +Y+ Sbjct: 534 YAYIVLVQAVLPLDKNLNDCNRQSILGRIIRVTDEVIEYR 573 >AY334007-1|AAR01132.1| 202|Anopheles gambiae odorant receptor 1 protein. Length = 202 Score = 24.2 bits (50), Expect = 2.8 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -1 Query: 284 LFRNQSGILYCLGFDMIVIIFSTSSSVHSPA 192 + R+ SG+ + + F M V IF+ V SPA Sbjct: 93 VLRSMSGVFWLMIFLMFVAIFTIIMWVMSPA 123 >AY334006-1|AAR01131.1| 202|Anopheles gambiae odorant receptor 1 protein. Length = 202 Score = 24.2 bits (50), Expect = 2.8 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -1 Query: 284 LFRNQSGILYCLGFDMIVIIFSTSSSVHSPA 192 + R+ SG+ + + F M V IF+ V SPA Sbjct: 93 VLRSMSGVFWLMIFLMFVAIFTIIMWVMSPA 123 >AY334005-1|AAR01130.1| 202|Anopheles gambiae odorant receptor 1 protein. Length = 202 Score = 24.2 bits (50), Expect = 2.8 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -1 Query: 284 LFRNQSGILYCLGFDMIVIIFSTSSSVHSPA 192 + R+ SG+ + + F M V IF+ V SPA Sbjct: 93 VLRSMSGVFWLMIFLMFVAIFTIIMWVMSPA 123 >U89803-1|AAD03794.1| 250|Anopheles gambiae Tc1-like transposase protein. Length = 250 Score = 23.8 bits (49), Expect = 3.7 Identities = 8/31 (25%), Positives = 17/31 (54%) Frame = -3 Query: 117 HRKHNLAFAIDVRIHDTKNMLKFVWNDQRHF 25 H+ + FAI+ D ++ + +W+D+ F Sbjct: 38 HKNARVLFAIEHMFFDEEDWRRVLWSDESKF 68 >AY176051-1|AAO19582.1| 522|Anopheles gambiae cytochrome P450 CYP12F1 protein. Length = 522 Score = 23.4 bits (48), Expect = 4.9 Identities = 18/54 (33%), Positives = 30/54 (55%), Gaps = 3/54 (5%) Frame = +1 Query: 241 SNPRQYK-IPD-WFLNRQKDIVDG-KYSQLTSSNLDSKLREDLERLKKIRAHRG 393 SN + YK IP L K+ +G +Y +LT ++L ++ R+D L +I+ G Sbjct: 39 SNAKPYKAIPSPKLLAFAKEFKEGGRYYELTGADLFARWRQDYGDLIRIKGMFG 92 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 23.4 bits (48), Expect = 4.9 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +3 Query: 87 RWQTQGYVCDDGY 125 RW GYVCDDG+ Sbjct: 787 RW---GYVCDDGF 796 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 23.4 bits (48), Expect = 4.9 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +3 Query: 87 RWQTQGYVCDDGY 125 RW GYVCDDG+ Sbjct: 786 RW---GYVCDDGF 795 >AF042732-3|AAC18058.1| 496|Anopheles gambiae diphenol oxidase-A2 protein. Length = 496 Score = 23.0 bits (47), Expect = 6.5 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +1 Query: 118 TAIKGVGLRYSNIVLKKADIDLDKRAGECTEEEVEKII 231 TAI+ +GL YS I + D+ ++ G + E+ E I+ Sbjct: 368 TAIRSIGLAYSRI----SPQDIARKLGLDSPEDAEFIV 401 >AF364130-1|AAL35506.1| 417|Anopheles gambiae putative odorant receptor Or1 protein. Length = 417 Score = 22.6 bits (46), Expect = 8.6 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -1 Query: 284 LFRNQSGILYCLGFDMIVIIFSTSSSVHSPA 192 + ++ SG+ + + F M V IF+ V SPA Sbjct: 127 VLQSMSGVFWLMIFLMFVAIFTIIMWVMSPA 157 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 508,432 Number of Sequences: 2352 Number of extensions: 10542 Number of successful extensions: 36 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 36 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 49897362 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -