BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0331 (701 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A5N1P5 Cluster: Putative uncharacterized protein; n=1; ... 34 3.9 UniRef50_UPI0000E87C89 Cluster: phosphate regulon sensor protein... 33 5.1 >UniRef50_A5N1P5 Cluster: Putative uncharacterized protein; n=1; Clostridium kluyveri DSM 555|Rep: Putative uncharacterized protein - Clostridium kluyveri DSM 555 Length = 467 Score = 33.9 bits (74), Expect = 3.9 Identities = 16/42 (38%), Positives = 22/42 (52%) Frame = -3 Query: 648 FVIVRTQLSLCLVDDLNNFRYIRLKLSFQSRRVYMKYMVLNK 523 FVI +SLCL N F+Y K+ + +Y+ Y LNK Sbjct: 225 FVIALILISLCLSIIYNFFKYYNFKMWADEKNIYINYGALNK 266 >UniRef50_UPI0000E87C89 Cluster: phosphate regulon sensor protein PhoR; n=1; Methylophilales bacterium HTCC2181|Rep: phosphate regulon sensor protein PhoR - Methylophilales bacterium HTCC2181 Length = 434 Score = 33.5 bits (73), Expect = 5.1 Identities = 16/49 (32%), Positives = 24/49 (48%) Frame = -1 Query: 494 SIFLLMLTLICCVSVLHV*MNFI*YWSEPIELWLEDPTITGISGYYSLW 348 S+F L +L+ S L + + F YW + WL +P I + Y LW Sbjct: 24 SVFDLETSLLFLASTLVLFLAFHIYWVYRLNQWLNNPMINNLPNGYGLW 72 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 583,470,290 Number of Sequences: 1657284 Number of extensions: 10198821 Number of successful extensions: 19073 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 18624 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19070 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 55785129165 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -