BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0331 (701 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4A8.11c |fas2|lsd1|fatty acid synthase alpha subunit Lsd1 |S... 26 4.5 SPAC10F6.01c ||SPAC4C5.05c|sulfite reductase beta subunit |Schiz... 26 4.5 SPAC16E8.07c |vph1||V-type ATPase subunit a|Schizosaccharomyces ... 26 6.0 >SPAC4A8.11c |fas2|lsd1|fatty acid synthase alpha subunit Lsd1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1842 Score = 26.2 bits (55), Expect = 4.5 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -1 Query: 404 ELWLEDPTITGISGYYSLWDIS 339 E W DPTI I G ++W ++ Sbjct: 1470 EFWKRDPTIAPIRGALAVWGLT 1491 >SPAC10F6.01c ||SPAC4C5.05c|sulfite reductase beta subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 1473 Score = 26.2 bits (55), Expect = 4.5 Identities = 17/54 (31%), Positives = 23/54 (42%) Frame = +1 Query: 154 HLSD*DPILFLSYCSKRGKNIHDRYWSWSPVCSTHSMSNFKHN*ENIRINLKKF 315 H +D D I L K + + W+P S+FK + E IR LK F Sbjct: 622 HSADDDAITVLQETKKAVDIGYWPLYRWTPALEDGEYSDFKLDSERIRRELKTF 675 >SPAC16E8.07c |vph1||V-type ATPase subunit a|Schizosaccharomyces pombe|chr 1|||Manual Length = 805 Score = 25.8 bits (54), Expect = 6.0 Identities = 14/55 (25%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Frame = -3 Query: 651 SFVIVRTQLSLCLVDDLNNFRYIRLKLSFQSRRVYMKYMV-LNKTFGMLLQDFIY 490 S ++ ++ CL L+N+R+ + KL + V++ ++ L FG L+ +Y Sbjct: 528 SIILGVIHMTFCLFLSLSNYRFFKRKLDIYA--VFVPSLIFLEAIFGYLVITIVY 580 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,578,808 Number of Sequences: 5004 Number of extensions: 48113 Number of successful extensions: 81 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 78 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 81 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 325165428 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -