BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0331 (701 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ494419-1|ABF55370.1| 127|Apis mellifera telomerase reverse tr... 22 6.5 DQ494418-1|ABF55369.1| 110|Apis mellifera telomerase reverse tr... 22 6.5 AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly pro... 22 6.5 AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 21 8.6 >DQ494419-1|ABF55370.1| 127|Apis mellifera telomerase reverse transcriptase protein. Length = 127 Score = 21.8 bits (44), Expect = 6.5 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = +3 Query: 411 LRPILDEVHSHMQN 452 ++ + D VH+H+QN Sbjct: 48 IKDLFDNVHNHIQN 61 >DQ494418-1|ABF55369.1| 110|Apis mellifera telomerase reverse transcriptase protein. Length = 110 Score = 21.8 bits (44), Expect = 6.5 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = +3 Query: 411 LRPILDEVHSHMQN 452 ++ + D VH+H+QN Sbjct: 31 IKDLFDNVHNHIQN 44 >AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly protein MRJP6 protein. Length = 437 Score = 21.8 bits (44), Expect = 6.5 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +2 Query: 287 KILGST*RNLVEFTRDAEIYPIMNSSRKY 373 +ILG+ NL++ TR A+ N+ KY Sbjct: 402 RILGANVNNLIKNTRCAKSNNQNNNQNKY 430 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 21.4 bits (43), Expect = 8.6 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +2 Query: 182 SYPTVQNGEKIFTTGIGHGHLCAALTVCPTSNIIKK 289 SY + N E+ I H HL LT +++KK Sbjct: 444 SYKSGLNLEQEKKDSISHYHLYTNLTALRKRDVLKK 479 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,557 Number of Sequences: 438 Number of extensions: 3237 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21561255 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -