BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0328 (595 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 194 6e-50 SB_3888| Best HMM Match : No HMM Matches (HMM E-Value=.) 139 2e-33 SB_32212| Best HMM Match : Histone (HMM E-Value=9.4e-33) 135 2e-32 SB_54197| Best HMM Match : Histone (HMM E-Value=9.4e-33) 134 7e-32 SB_32396| Best HMM Match : Histone (HMM E-Value=9.4e-33) 134 7e-32 SB_31835| Best HMM Match : Histone (HMM E-Value=9.4e-33) 134 7e-32 SB_28838| Best HMM Match : Histone (HMM E-Value=9.4e-33) 134 7e-32 SB_14747| Best HMM Match : Histone (HMM E-Value=9.4e-33) 134 7e-32 SB_54382| Best HMM Match : Histone (HMM E-Value=9.4e-33) 134 7e-32 SB_45182| Best HMM Match : Histone (HMM E-Value=9.4e-33) 134 7e-32 SB_42476| Best HMM Match : Histone (HMM E-Value=9.4e-33) 134 7e-32 SB_25226| Best HMM Match : Histone (HMM E-Value=9.4e-33) 134 7e-32 SB_19336| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 7e-32 SB_11028| Best HMM Match : Histone (HMM E-Value=9.4e-33) 134 7e-32 SB_9842| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 7e-32 SB_8583| Best HMM Match : Histone (HMM E-Value=9.4e-33) 134 7e-32 SB_8319| Best HMM Match : Histone (HMM E-Value=9.4e-33) 134 7e-32 SB_7498| Best HMM Match : Histone (HMM E-Value=9.4e-33) 134 7e-32 SB_5065| Best HMM Match : Histone (HMM E-Value=2.6e-33) 133 9e-32 SB_24673| Best HMM Match : No HMM Matches (HMM E-Value=.) 133 9e-32 SB_54557| Best HMM Match : PHK_AB (HMM E-Value=0) 132 2e-31 SB_1956| Best HMM Match : No HMM Matches (HMM E-Value=.) 132 2e-31 SB_38873| Best HMM Match : Histone (HMM E-Value=2.6e-33) 132 2e-31 SB_56156| Best HMM Match : No HMM Matches (HMM E-Value=.) 132 3e-31 SB_55462| Best HMM Match : Histone (HMM E-Value=4.8e-33) 132 3e-31 SB_48204| Best HMM Match : Histone (HMM E-Value=2.7e-32) 132 3e-31 SB_46252| Best HMM Match : Histone (HMM E-Value=4.8e-33) 132 3e-31 SB_29633| Best HMM Match : Histone (HMM E-Value=5.3e-31) 132 3e-31 SB_1105| Best HMM Match : No HMM Matches (HMM E-Value=.) 132 3e-31 SB_26809| Best HMM Match : Histone (HMM E-Value=4.8e-33) 132 3e-31 SB_25701| Best HMM Match : Histone (HMM E-Value=4.8e-33) 132 3e-31 SB_54707| Best HMM Match : Histone (HMM E-Value=9.4e-33) 131 4e-31 SB_57971| Best HMM Match : Histone (HMM E-Value=5.4e-33) 130 6e-31 SB_55892| Best HMM Match : Histone (HMM E-Value=9.4e-33) 130 6e-31 SB_31727| Best HMM Match : Histone (HMM E-Value=5e-33) 127 6e-30 SB_18628| Best HMM Match : Histone (HMM E-Value=1.5e-31) 125 3e-29 SB_56326| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 8e-23 SB_28189| Best HMM Match : Histone (HMM E-Value=1.5e-12) 98 4e-21 SB_31723| Best HMM Match : Histone (HMM E-Value=0.016) 86 2e-17 SB_58649| Best HMM Match : Histone (HMM E-Value=4.5e-12) 85 5e-17 SB_44162| Best HMM Match : Histone (HMM E-Value=0.00016) 74 8e-14 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 72 4e-13 SB_30055| Best HMM Match : Histone (HMM E-Value=0.97) 56 2e-08 SB_55494| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_44025| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_50166| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_30489| Best HMM Match : HEAT (HMM E-Value=9.2e-17) 31 0.70 SB_38686| Best HMM Match : 7tm_1 (HMM E-Value=5.70048e-42) 29 2.1 SB_20073| Best HMM Match : F5_F8_type_C (HMM E-Value=2.9e-18) 29 2.8 SB_16639| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_25269| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_46195| Best HMM Match : Mpv17_PMP22 (HMM E-Value=3.3) 28 6.5 SB_27184| Best HMM Match : 7tm_1 (HMM E-Value=1.8e-05) 28 6.5 SB_23902| Best HMM Match : Pkinase (HMM E-Value=2.29813e-43) 28 6.5 SB_30088| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_22486| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_22305| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_19506| Best HMM Match : Viral_helicase1 (HMM E-Value=2.7) 28 6.5 SB_54534| Best HMM Match : IRF (HMM E-Value=0.0051) 27 8.6 SB_42109| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_18868| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_11329| Best HMM Match : DUF1151 (HMM E-Value=0.0015) 27 8.6 SB_9414| Best HMM Match : 7tm_1 (HMM E-Value=0.051) 27 8.6 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 194 bits (472), Expect = 6e-50 Identities = 96/98 (97%), Positives = 98/98 (100%) Frame = +1 Query: 55 SQAKAVSRSARAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGN 234 ++AKAVSRSARAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGN Sbjct: 83 AKAKAVSRSARAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGN 142 Query: 235 ASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGV 348 ASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGV Sbjct: 143 ASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGV 180 >SB_3888| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 986 Score = 139 bits (336), Expect = 2e-33 Identities = 68/112 (60%), Positives = 87/112 (77%), Gaps = 1/112 (0%) Frame = +1 Query: 58 QAKAVSRSARAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNA 237 +AKAVSRSA+AGLQFPV R+HR+L+ + T H R+ A A VY AA++EYLTAE+LELAGNA Sbjct: 646 RAKAVSRSAKAGLQFPVSRVHRYLR-KCTHHYRISAAAPVYQAAVMEYLTAEILELAGNA 704 Query: 238 SKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKKGG 390 ++D K RI PRH+ LA+ DEEL L+K TIA GGV+P+IH L+ K+ G Sbjct: 705 ARDNKKTRIIPRHILLAVANDEELHKLLKGVTIASGGVLPNIHPELLKKRKG 756 >SB_32212| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 135 bits (327), Expect = 2e-32 Identities = 70/108 (64%), Positives = 86/108 (79%), Gaps = 1/108 (0%) Frame = +1 Query: 64 KAVSRSARAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 243 K+ +RS+RAGLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 13 KSKTRSSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Query: 244 DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 384 D K RI PRHLQLA+R DEEL+ L+ ATIA GGV+P+I SL+ KK Sbjct: 72 DNKKTRIIPRHLQLAVRNDEELNRLLHGATIAQGGVLPNIQASLLPKK 119 >SB_54197| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 134 bits (323), Expect = 7e-32 Identities = 69/108 (63%), Positives = 85/108 (78%), Gaps = 1/108 (0%) Frame = +1 Query: 64 KAVSRSARAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 243 K+ +RS+RAGLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 13 KSKTRSSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Query: 244 DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 384 D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 72 DNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_32396| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 134 bits (323), Expect = 7e-32 Identities = 69/108 (63%), Positives = 85/108 (78%), Gaps = 1/108 (0%) Frame = +1 Query: 64 KAVSRSARAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 243 K+ +RS+RAGLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 13 KSKTRSSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Query: 244 DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 384 D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 72 DNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_31835| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 134 bits (323), Expect = 7e-32 Identities = 69/108 (63%), Positives = 85/108 (78%), Gaps = 1/108 (0%) Frame = +1 Query: 64 KAVSRSARAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 243 K+ +RS+RAGLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 13 KSKTRSSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Query: 244 DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 384 D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 72 DNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_28838| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 134 bits (323), Expect = 7e-32 Identities = 69/108 (63%), Positives = 85/108 (78%), Gaps = 1/108 (0%) Frame = +1 Query: 64 KAVSRSARAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 243 K+ +RS+RAGLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 13 KSKTRSSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Query: 244 DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 384 D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 72 DNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_14747| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 134 bits (323), Expect = 7e-32 Identities = 69/108 (63%), Positives = 85/108 (78%), Gaps = 1/108 (0%) Frame = +1 Query: 64 KAVSRSARAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 243 K+ +RS+RAGLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 13 KSKTRSSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Query: 244 DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 384 D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 72 DNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_54382| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 134 bits (323), Expect = 7e-32 Identities = 69/108 (63%), Positives = 85/108 (78%), Gaps = 1/108 (0%) Frame = +1 Query: 64 KAVSRSARAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 243 K+ +RS+RAGLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 13 KSKTRSSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Query: 244 DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 384 D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 72 DNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_45182| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 134 bits (323), Expect = 7e-32 Identities = 69/108 (63%), Positives = 85/108 (78%), Gaps = 1/108 (0%) Frame = +1 Query: 64 KAVSRSARAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 243 K+ +RS+RAGLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 13 KSKTRSSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Query: 244 DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 384 D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 72 DNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_42476| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 134 bits (323), Expect = 7e-32 Identities = 69/108 (63%), Positives = 85/108 (78%), Gaps = 1/108 (0%) Frame = +1 Query: 64 KAVSRSARAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 243 K+ +RS+RAGLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 13 KSKTRSSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Query: 244 DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 384 D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 72 DNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_25226| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 134 bits (323), Expect = 7e-32 Identities = 69/108 (63%), Positives = 85/108 (78%), Gaps = 1/108 (0%) Frame = +1 Query: 64 KAVSRSARAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 243 K+ +RS+RAGLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 13 KSKTRSSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Query: 244 DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 384 D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 72 DNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_19336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 134 bits (323), Expect = 7e-32 Identities = 69/108 (63%), Positives = 85/108 (78%), Gaps = 1/108 (0%) Frame = +1 Query: 64 KAVSRSARAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 243 K+ +RS+RAGLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 13 KSKTRSSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Query: 244 DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 384 D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 72 DNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_11028| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 134 bits (323), Expect = 7e-32 Identities = 69/108 (63%), Positives = 85/108 (78%), Gaps = 1/108 (0%) Frame = +1 Query: 64 KAVSRSARAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 243 K+ +RS+RAGLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 13 KSKTRSSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Query: 244 DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 384 D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 72 DNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_9842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 134 bits (323), Expect = 7e-32 Identities = 69/108 (63%), Positives = 85/108 (78%), Gaps = 1/108 (0%) Frame = +1 Query: 64 KAVSRSARAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 243 K+ +RS+RAGLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 13 KSKTRSSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Query: 244 DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 384 D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 72 DNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_8583| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 134 bits (323), Expect = 7e-32 Identities = 69/108 (63%), Positives = 85/108 (78%), Gaps = 1/108 (0%) Frame = +1 Query: 64 KAVSRSARAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 243 K+ +RS+RAGLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 13 KSKTRSSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Query: 244 DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 384 D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 72 DNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_8319| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 134 bits (323), Expect = 7e-32 Identities = 69/108 (63%), Positives = 85/108 (78%), Gaps = 1/108 (0%) Frame = +1 Query: 64 KAVSRSARAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 243 K+ +RS+RAGLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 13 KSKTRSSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Query: 244 DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 384 D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 72 DNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_7498| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 134 bits (323), Expect = 7e-32 Identities = 69/108 (63%), Positives = 85/108 (78%), Gaps = 1/108 (0%) Frame = +1 Query: 64 KAVSRSARAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 243 K+ +RS+RAGLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 13 KSKTRSSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Query: 244 DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 384 D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 72 DNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_5065| Best HMM Match : Histone (HMM E-Value=2.6e-33) Length = 330 Score = 133 bits (322), Expect = 9e-32 Identities = 70/111 (63%), Positives = 85/111 (76%), Gaps = 1/111 (0%) Frame = +1 Query: 55 SQAKAVSRSARAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGN 234 S+AK SRSARAGLQFPVGR+HR L+ + RVGA A VY AA+LEYL+AE+LELAGN Sbjct: 10 SRAKGKSRSARAGLQFPVGRVHRFLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGN 68 Query: 235 ASKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 384 A++D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 69 AARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 119 >SB_24673| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 732 Score = 133 bits (322), Expect = 9e-32 Identities = 70/111 (63%), Positives = 85/111 (76%), Gaps = 1/111 (0%) Frame = +1 Query: 55 SQAKAVSRSARAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGN 234 S+AK SRSARAGLQFPVGR+HR L+ + RVGA A VY AA+LEYL+AE+LELAGN Sbjct: 10 SRAKGKSRSARAGLQFPVGRVHRFLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGN 68 Query: 235 ASKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 384 A++D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 69 AARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 119 >SB_54557| Best HMM Match : PHK_AB (HMM E-Value=0) Length = 863 Score = 132 bits (320), Expect = 2e-31 Identities = 68/108 (62%), Positives = 85/108 (78%), Gaps = 1/108 (0%) Frame = +1 Query: 64 KAVSRSARAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 243 K+ +RS+RAGLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 750 KSKTRSSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 808 Query: 244 DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 384 D K RI PRHLQLA+R DEEL+ L++ TIA GGV+P+I L+ KK Sbjct: 809 DNKKTRIIPRHLQLAVRNDEELNRLLRGVTIAQGGVLPNIQAVLLPKK 856 >SB_1956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 132 bits (319), Expect = 2e-31 Identities = 69/111 (62%), Positives = 85/111 (76%), Gaps = 1/111 (0%) Frame = +1 Query: 55 SQAKAVSRSARAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGN 234 S+AK SRSARAGLQFPVGR+HR L+ + RVGA A VY AA+LEYL+AE+LELAGN Sbjct: 10 SRAKGKSRSARAGLQFPVGRVHRFLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGN 68 Query: 235 ASKDLKVKRITPRHLQLAIRGDEELDSLI-KATIAGGGVIPHIHKSLIGKK 384 A++D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ K+ Sbjct: 69 AARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKR 119 >SB_38873| Best HMM Match : Histone (HMM E-Value=2.6e-33) Length = 125 Score = 132 bits (319), Expect = 2e-31 Identities = 69/111 (62%), Positives = 85/111 (76%), Gaps = 1/111 (0%) Frame = +1 Query: 55 SQAKAVSRSARAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGN 234 S+AK SRSARAGLQFPVGR+HR L+ + RVGA A VY AA+LEYL+AE+LELAGN Sbjct: 10 SRAKGKSRSARAGLQFPVGRVHRFLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGN 68 Query: 235 ASKDLKVKRITPRHLQLAIRGDEELDSLI-KATIAGGGVIPHIHKSLIGKK 384 A++D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ K+ Sbjct: 69 AARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKR 119 >SB_56156| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 132 bits (318), Expect = 3e-31 Identities = 68/108 (62%), Positives = 84/108 (77%), Gaps = 1/108 (0%) Frame = +1 Query: 64 KAVSRSARAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 243 K+ +RS+RAGLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 13 KSKTRSSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGNAAR 71 Query: 244 DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 384 D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 72 DNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 119 >SB_55462| Best HMM Match : Histone (HMM E-Value=4.8e-33) Length = 126 Score = 132 bits (318), Expect = 3e-31 Identities = 68/108 (62%), Positives = 84/108 (77%), Gaps = 1/108 (0%) Frame = +1 Query: 64 KAVSRSARAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 243 K+ +RS+RAGLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 13 KSKTRSSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGNAAR 71 Query: 244 DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 384 D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 72 DNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 119 >SB_48204| Best HMM Match : Histone (HMM E-Value=2.7e-32) Length = 125 Score = 132 bits (318), Expect = 3e-31 Identities = 69/108 (63%), Positives = 84/108 (77%), Gaps = 1/108 (0%) Frame = +1 Query: 64 KAVSRSARAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 243 K+ +RS+RAGLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA+ Sbjct: 13 KSKTRSSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAC 71 Query: 244 DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 384 D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 72 DNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_46252| Best HMM Match : Histone (HMM E-Value=4.8e-33) Length = 134 Score = 132 bits (318), Expect = 3e-31 Identities = 68/108 (62%), Positives = 84/108 (77%), Gaps = 1/108 (0%) Frame = +1 Query: 64 KAVSRSARAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 243 K+ +RS+RAGLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 21 KSKTRSSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGNAAR 79 Query: 244 DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 384 D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 80 DNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 127 >SB_29633| Best HMM Match : Histone (HMM E-Value=5.3e-31) Length = 125 Score = 132 bits (318), Expect = 3e-31 Identities = 68/108 (62%), Positives = 85/108 (78%), Gaps = 1/108 (0%) Frame = +1 Query: 64 KAVSRSARAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 243 K+ +RS+RAGLQFPVGRIHRHL+ + RVGA A V+ AA+LEYL+AE+LELAGNA++ Sbjct: 13 KSKTRSSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVHLAAVLEYLSAEILELAGNAAR 71 Query: 244 DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 384 D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 72 DNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_1105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 496 Score = 132 bits (318), Expect = 3e-31 Identities = 68/108 (62%), Positives = 84/108 (77%), Gaps = 1/108 (0%) Frame = +1 Query: 64 KAVSRSARAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 243 K+ +RS+RAGLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 383 KSKTRSSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGNAAR 441 Query: 244 DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 384 D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 442 DNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 489 >SB_26809| Best HMM Match : Histone (HMM E-Value=4.8e-33) Length = 126 Score = 132 bits (318), Expect = 3e-31 Identities = 68/108 (62%), Positives = 84/108 (77%), Gaps = 1/108 (0%) Frame = +1 Query: 64 KAVSRSARAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 243 K+ +RS+RAGLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 13 KSKTRSSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGNAAR 71 Query: 244 DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 384 D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 72 DNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 119 >SB_25701| Best HMM Match : Histone (HMM E-Value=4.8e-33) Length = 126 Score = 132 bits (318), Expect = 3e-31 Identities = 68/108 (62%), Positives = 84/108 (77%), Gaps = 1/108 (0%) Frame = +1 Query: 64 KAVSRSARAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 243 K+ +RS+RAGLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 13 KSKTRSSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGNAAR 71 Query: 244 DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 384 D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 72 DNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 119 >SB_54707| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 126 Score = 131 bits (317), Expect = 4e-31 Identities = 68/108 (62%), Positives = 84/108 (77%), Gaps = 1/108 (0%) Frame = +1 Query: 64 KAVSRSARAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 243 K+ +RS+RAGLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 13 KSKTRSSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Query: 244 DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 384 D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 72 DNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 119 >SB_57971| Best HMM Match : Histone (HMM E-Value=5.4e-33) Length = 125 Score = 130 bits (315), Expect = 6e-31 Identities = 68/111 (61%), Positives = 85/111 (76%), Gaps = 1/111 (0%) Frame = +1 Query: 55 SQAKAVSRSARAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGN 234 S+AK SRSA+AGLQFPVGR+HR L+ + RVGA A VY AA+LEYL+AE+LELAGN Sbjct: 10 SRAKGKSRSAKAGLQFPVGRVHRFLRKGNYAK-RVGAGAPVYMAAVLEYLSAEILELAGN 68 Query: 235 ASKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 384 A++D K RI PRHLQLA+R DEEL+ L+ TI+ GGV+P+I L+ KK Sbjct: 69 AARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTISQGGVLPNIQAVLLPKK 119 >SB_55892| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 130 bits (315), Expect = 6e-31 Identities = 68/108 (62%), Positives = 84/108 (77%), Gaps = 1/108 (0%) Frame = +1 Query: 64 KAVSRSARAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 243 K+ +RS+RAGLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 13 KSKTRSSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Query: 244 DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 384 D K RI PRHLQLA+R DEEL+ L+ TIA G V+P+I SL+ KK Sbjct: 72 DNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGRVLPNIQASLLPKK 119 >SB_31727| Best HMM Match : Histone (HMM E-Value=5e-33) Length = 126 Score = 127 bits (307), Expect = 6e-30 Identities = 67/108 (62%), Positives = 83/108 (76%), Gaps = 1/108 (0%) Frame = +1 Query: 64 KAVSRSARAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 243 K+ +RS+RAGLQFPVGRIHR L+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 13 KSKTRSSRAGLQFPVGRIHRLLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGNAAR 71 Query: 244 DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 384 D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 72 DNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 119 >SB_18628| Best HMM Match : Histone (HMM E-Value=1.5e-31) Length = 126 Score = 125 bits (301), Expect = 3e-29 Identities = 66/108 (61%), Positives = 82/108 (75%), Gaps = 1/108 (0%) Frame = +1 Query: 64 KAVSRSARAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 243 K+ +RS+RAGLQFPVGRIHR L+ + RVGA VY AA+LEYL+AE+LELAGNA++ Sbjct: 13 KSKTRSSRAGLQFPVGRIHRLLRKGNYAE-RVGAGDPVYMAAVLEYLSAEILELAGNAAR 71 Query: 244 DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 384 D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 72 DNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 119 >SB_56326| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 103 bits (248), Expect = 8e-23 Identities = 52/82 (63%), Positives = 63/82 (76%), Gaps = 1/82 (1%) Frame = +1 Query: 154 RVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIK-AT 330 RVGA A VY AA+LEYLTAE+LELAGNA++D K RI PRHLQLA+R DEEL+ L++ T Sbjct: 6 RVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKSRIVPRHLQLAVRNDEELNKLLQGVT 65 Query: 331 IAGGGVIPHIHKSLIGKKGGPG 396 IA GGV+P+I L+ KK G Sbjct: 66 IAQGGVLPNIQAVLLPKKSNTG 87 >SB_28189| Best HMM Match : Histone (HMM E-Value=1.5e-12) Length = 90 Score = 98.3 bits (234), Expect = 4e-21 Identities = 50/78 (64%), Positives = 61/78 (78%), Gaps = 1/78 (1%) Frame = +1 Query: 154 RVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIK-AT 330 RVGA A VY AA+LEYL+AE+LELAGNA++D K RI PRHLQLA+R DEEL+ L+ T Sbjct: 6 RVGAGAPVYMAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVT 65 Query: 331 IAGGGVIPHIHKSLIGKK 384 IA GGV+P+I L+ KK Sbjct: 66 IAQGGVLPNIQAVLLPKK 83 >SB_31723| Best HMM Match : Histone (HMM E-Value=0.016) Length = 76 Score = 86.2 bits (204), Expect = 2e-17 Identities = 43/68 (63%), Positives = 54/68 (79%), Gaps = 1/68 (1%) Frame = +1 Query: 184 AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHI 360 AA+LEYL+AE+LELAGNA++D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I Sbjct: 2 AAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNI 61 Query: 361 HKSLIGKK 384 L+ KK Sbjct: 62 QAVLLPKK 69 >SB_58649| Best HMM Match : Histone (HMM E-Value=4.5e-12) Length = 74 Score = 84.6 bits (200), Expect = 5e-17 Identities = 41/63 (65%), Positives = 52/63 (82%) Frame = +1 Query: 64 KAVSRSARAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 243 K+ +RS+RAGLQFP+GRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 13 KSKTRSSRAGLQFPIGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Query: 244 DLK 252 D K Sbjct: 72 DNK 74 >SB_44162| Best HMM Match : Histone (HMM E-Value=0.00016) Length = 67 Score = 74.1 bits (174), Expect = 8e-14 Identities = 37/55 (67%), Positives = 45/55 (81%) Frame = +1 Query: 64 KAVSRSARAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELA 228 K+ +RS+RAGLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELA Sbjct: 13 KSKTRSSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELA 66 >SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) Length = 150 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/53 (67%), Positives = 43/53 (81%), Gaps = 1/53 (1%) Frame = +1 Query: 193 LEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGV 348 LEYL+AE+LELAGNA++D K RI PRHLQLA+R DEEL+ L+ TIA GGV Sbjct: 2 LEYLSAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGV 54 >SB_30055| Best HMM Match : Histone (HMM E-Value=0.97) Length = 129 Score = 56.0 bits (129), Expect = 2e-08 Identities = 28/44 (63%), Positives = 34/44 (77%) Frame = +1 Query: 64 KAVSRSARAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAIL 195 K+ +RS+RAGLQFPVGRIHRHL+ + RVGA A VY AA+L Sbjct: 86 KSKTRSSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYMAAVL 128 >SB_55494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 664 Score = 46.0 bits (104), Expect = 2e-05 Identities = 30/82 (36%), Positives = 44/82 (53%) Frame = +1 Query: 73 SRSARAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK 252 S+ AR+GL FPVGRI R L + + RV AA+Y AA LEY+ E + A + Sbjct: 65 SKRARSGLVFPVGRIFRWLLDMKVA-CRVYDAAAIYLAATLEYIAEETIYRAVTTRE--V 121 Query: 253 VKRITPRHLQLAIRGDEELDSL 318 + + P ++ + D +L SL Sbjct: 122 IDHVVPETVEKCVNMDPDLWSL 143 >SB_44025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 35 Score = 42.7 bits (96), Expect = 2e-04 Identities = 18/22 (81%), Positives = 21/22 (95%) Frame = +1 Query: 64 KAVSRSARAGLQFPVGRIHRHL 129 K+ +RS+RAGLQFPVGRIHRHL Sbjct: 13 KSKTRSSRAGLQFPVGRIHRHL 34 >SB_50166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 41 Score = 35.9 bits (79), Expect = 0.025 Identities = 18/35 (51%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = +1 Query: 283 LAIRGDEELDSLIKA-TIAGGGVIPHIHKSLIGKK 384 LA+R DEEL+ L+ TIA GGV+P+I L+ K+ Sbjct: 1 LAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKR 35 >SB_30489| Best HMM Match : HEAT (HMM E-Value=9.2e-17) Length = 722 Score = 31.1 bits (67), Expect = 0.70 Identities = 23/76 (30%), Positives = 34/76 (44%), Gaps = 6/76 (7%) Frame = -2 Query: 339 ASDSCFYEAVQFF---ISSNSKL*VPRSNTLHF*IFRRISR---QLQNLCCKIFQNSGRI 178 +SD +Y+ V +SSN L V + +F R +R Q Q LCC++ Q GR Sbjct: 241 SSDQIYYKFVPLLFRLLSSNRVLPVKLAAARTLCVFIRYNRRYEQRQELCCRLIQECGRG 300 Query: 177 NCCRSSYAPVACCPIL 130 RS + C + Sbjct: 301 KSYRSRLLFIDICKFI 316 >SB_38686| Best HMM Match : 7tm_1 (HMM E-Value=5.70048e-42) Length = 366 Score = 29.5 bits (63), Expect = 2.1 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +2 Query: 326 QLSLAEASSHTYTNLSLERKAVLVHPFNFKL 418 Q +L S T+T ++LER ++HPF KL Sbjct: 119 QDALVSVSVFTFTAIALERYRAIIHPFKPKL 149 >SB_20073| Best HMM Match : F5_F8_type_C (HMM E-Value=2.9e-18) Length = 593 Score = 29.1 bits (62), Expect = 2.8 Identities = 19/76 (25%), Positives = 31/76 (40%), Gaps = 3/76 (3%) Frame = +1 Query: 178 YSAAILEYLTAEVLELAGNASKDLKVK---RITPRHLQLAIRGDEELDSLIKATIAGGGV 348 Y AA TA + A + L +T +H+ + R + LIK + G Sbjct: 176 YKAASTMVTTATSMVTAPTSKTSLTTTLRPALTAKHINITNRTANVVKKLIKIGLLTNGS 235 Query: 349 IPHIHKSLIGKKGGPG 396 H+H+ L G++ G Sbjct: 236 TTHVHRFLKGQRNNTG 251 >SB_16639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 358 Score = 28.3 bits (60), Expect = 4.9 Identities = 12/38 (31%), Positives = 23/38 (60%) Frame = +2 Query: 326 QLSLAEASSHTYTNLSLERKAVLVHPFNFKL*DDKIIL 439 Q +L S +T+ ++LER +++PF KL K+++ Sbjct: 115 QDALVSVSVYTFVVIALERYRAIINPFKPKLSKSKVLI 152 >SB_25269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 871 Score = 28.3 bits (60), Expect = 4.9 Identities = 17/59 (28%), Positives = 24/59 (40%), Gaps = 3/59 (5%) Frame = -2 Query: 483 GDDLCRCVTTAGIKCSIILSSHNLKLNGCTRTAFLSNERFVYVWDDAS---ASDSCFYE 316 G CR + T G +C ++ S K N C F + F + +A DSC E Sbjct: 632 GSITCRIIKTVGDRCLDLVPSRIFKHNSCGIALFQNTYMFFFEGSNADCFPVHDSCAKE 690 >SB_46195| Best HMM Match : Mpv17_PMP22 (HMM E-Value=3.3) Length = 354 Score = 27.9 bits (59), Expect = 6.5 Identities = 20/75 (26%), Positives = 34/75 (45%), Gaps = 3/75 (4%) Frame = -2 Query: 498 MLTNLGDDLCRCVTTAGIKCSIILSSHNLKLNGCTRT---AFLSNERFVYVWDDASASDS 328 +L LGD R A + +L + LN C+ T AF+ N+ ++ W + S Sbjct: 231 LLWKLGDTSERKKLIATKEALALLRTSENLLNNCSNTRIDAFIDNQALLFSWHKQVSKSS 290 Query: 327 CFYEAVQFFISSNSK 283 + ++ F SS S+ Sbjct: 291 EISDIMKKFPSSYSR 305 >SB_27184| Best HMM Match : 7tm_1 (HMM E-Value=1.8e-05) Length = 170 Score = 27.9 bits (59), Expect = 6.5 Identities = 16/35 (45%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = +2 Query: 335 LAEASSHTYTNLSLERKAVLVHP--FNFKL*DDKI 433 L ASS T T L++ER +VHP FKL D + Sbjct: 91 LTTASSFTLTVLAVERYQAIVHPMCMRFKLRDGAV 125 >SB_23902| Best HMM Match : Pkinase (HMM E-Value=2.29813e-43) Length = 1602 Score = 27.9 bits (59), Expect = 6.5 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = +1 Query: 304 ELDSLIKATIAGGGVIPHIHKSLIGKKGGP 393 ++ S++K TI+ + H+H +IG +G P Sbjct: 307 DMKSMLKLTISIASGLAHLHMEIIGTQGKP 336 >SB_30088| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 27.9 bits (59), Expect = 6.5 Identities = 16/55 (29%), Positives = 30/55 (54%), Gaps = 3/55 (5%) Frame = -2 Query: 438 SIILSSHNLKLNGCTRT---AFLSNERFVYVWDDASASDSCFYEAVQFFISSNSK 283 +++ +S NL LN C+ T AF+ N+ ++ W + S + ++ F SS S+ Sbjct: 206 ALLRTSENL-LNNCSNTRIDAFIDNQALLFSWHKQVSKSSEISDIMKKFSSSYSR 259 >SB_22486| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 497 Score = 27.9 bits (59), Expect = 6.5 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +2 Query: 338 AEASSHTYTNLSLERKAVLVHPFNFKL 418 A ++S T T LSL+R V++HPF +L Sbjct: 118 ATSASLTLTVLSLDRYRVIMHPFQERL 144 >SB_22305| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 357 Score = 27.9 bits (59), Expect = 6.5 Identities = 16/55 (29%), Positives = 30/55 (54%), Gaps = 3/55 (5%) Frame = -2 Query: 438 SIILSSHNLKLNGCTRT---AFLSNERFVYVWDDASASDSCFYEAVQFFISSNSK 283 +++ +S NL LN C+ T AF+ N+ ++ W + S + ++ F SS S+ Sbjct: 255 ALLRTSENL-LNNCSNTRIDAFIDNQALLFSWHKQVSKSSEISDIMKKFSSSYSR 308 >SB_19506| Best HMM Match : Viral_helicase1 (HMM E-Value=2.7) Length = 828 Score = 27.9 bits (59), Expect = 6.5 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Frame = +1 Query: 217 LELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKA-TIAGGGVIPHIHKSLIGKKGGP 393 LE N +K L+ RI P H + + + KA + GG++PH++ ++I GP Sbjct: 614 LEWGRNKTKILECNRI-PGHPVANMNAENHGNHAQKADSNKAGGLLPHLYSAVIASYTGP 672 >SB_54534| Best HMM Match : IRF (HMM E-Value=0.0051) Length = 217 Score = 27.5 bits (58), Expect = 8.6 Identities = 17/55 (30%), Positives = 27/55 (49%) Frame = +1 Query: 106 VGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITP 270 VG+ R LK +T G T AV + + +++LEL+ L+ KR +P Sbjct: 41 VGKEPRTLKAKTAEQGARPKTLAVGGSKKPKVTQSDILELSRQVESLLEEKRTSP 95 >SB_42109| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 27.5 bits (58), Expect = 8.6 Identities = 18/45 (40%), Positives = 25/45 (55%) Frame = -3 Query: 314 LSNSSSPLIASCKCRGVIRFTFKSLDAFPANSKTSAVRYSKIAAE 180 LSN SP +A K R R T K++DA + K S++ K+A E Sbjct: 28 LSNDESPALAE-KERHDKRNTNKTMDATNSGDKKSSIGKLKVARE 71 >SB_18868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 516 Score = 27.5 bits (58), Expect = 8.6 Identities = 16/53 (30%), Positives = 24/53 (45%) Frame = +1 Query: 106 VGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRI 264 VG++HR K +T G T AV + +LEL+ N L+ R+ Sbjct: 163 VGKVHRTPKAKTKERGARPNTLAVGGCKKSKVTQGHILELSRNVESLLEENRL 215 >SB_11329| Best HMM Match : DUF1151 (HMM E-Value=0.0015) Length = 746 Score = 27.5 bits (58), Expect = 8.6 Identities = 17/55 (30%), Positives = 27/55 (49%) Frame = +1 Query: 106 VGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITP 270 VG+ R LK +T G T AV + + +++LEL+ L+ KR +P Sbjct: 302 VGKEPRTLKAKTAEQGARPKTLAVGGSKKPKVTQSDILELSRQVESLLEEKRTSP 356 >SB_9414| Best HMM Match : 7tm_1 (HMM E-Value=0.051) Length = 334 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/57 (21%), Positives = 28/57 (49%), Gaps = 2/57 (3%) Frame = -3 Query: 356 CGMTPPPAIVAFMRLSNSSSPLIASCKC--RGVIRFTFKSLDAFPANSKTSAVRYSK 192 CG +P A+V+ RL ++ ++ C C R +++++ + N + + S+ Sbjct: 265 CGCSPLIAMVSMKRLKRATKRIVCMCLCPERAILKYSQSRRSSRKKNGAVTLLEMSR 321 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,866,723 Number of Sequences: 59808 Number of extensions: 386916 Number of successful extensions: 1119 Number of sequences better than 10.0: 63 Number of HSP's better than 10.0 without gapping: 931 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1040 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1427401750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -