BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0328 (595 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 24 1.3 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 23 2.3 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 23 2.3 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 23 3.0 AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 22 5.2 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 23.8 bits (49), Expect = 1.3 Identities = 11/39 (28%), Positives = 17/39 (43%) Frame = -3 Query: 263 IRFTFKSLDAFPANSKTSAVRYSKIAAE*TAAVAPTRPW 147 I+FT + FP N+ + +S + E A PW Sbjct: 90 IKFTTRDCSLFPGNALSCKETFSLLYYEFDVATKEPPPW 128 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 23.0 bits (47), Expect = 2.3 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = -3 Query: 323 FMRLSNSSSPLIASCKCRGVIRFTFKSLDAFPANS 219 FMR+ N ++ G ++F L FP+NS Sbjct: 276 FMRIFNLICMMLLIGHWSGCLQFLVPMLQGFPSNS 310 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 23.0 bits (47), Expect = 2.3 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = -3 Query: 323 FMRLSNSSSPLIASCKCRGVIRFTFKSLDAFPANS 219 FMR+ N ++ G ++F L FP+NS Sbjct: 244 FMRIFNLICMMLLIGHWSGCLQFLVPMLQGFPSNS 278 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 22.6 bits (46), Expect = 3.0 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 590 ISITYSYIFSPDQQFQSH 537 I+ TYS SPD QF ++ Sbjct: 474 INFTYSLALSPDGQFGNY 491 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 21.8 bits (44), Expect = 5.2 Identities = 18/55 (32%), Positives = 28/55 (50%) Frame = +2 Query: 353 HTYTNLSLERKAVLVHPFNFKL*DDKIILHLIPAVVTHLHKSSPRLVNIVFY*NN 517 H YTNL+ RK ++ NF + +I+ + AVV + + L+ I F NN Sbjct: 463 HLYTNLTALRKRDVLKKGNFTI---EILNKTVLAVVRQSEEEAVSLL-INFSKNN 513 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 161,779 Number of Sequences: 438 Number of extensions: 3712 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17359926 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -