Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NRPG0327
         (642 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

M93689-2|AAA29367.1|  975|Anopheles gambiae protein ( Anopheles ...    25   2.0  
AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcript...    23   8.2  

>M93689-2|AAA29367.1|  975|Anopheles gambiae protein ( Anopheles
            gambiae T1 retroposon. ).
          Length = 975

 Score = 25.0 bits (52), Expect = 2.0
 Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 1/30 (3%)
 Frame = +3

Query: 399  FTINDQIITYLISFLHFYVLWCF-SNIGKF 485
            +T ND I++    F HFY L+ F S++  F
Sbjct: 936  YTFNDPILSCFRLFNHFYYLFDFDSSLNSF 965


>AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1209

 Score = 23.0 bits (47), Expect = 8.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = +1

Query: 283 YVYNFWYTILLS 318
           +VYNFWY  L++
Sbjct: 480 FVYNFWYKKLIT 491


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 603,744
Number of Sequences: 2352
Number of extensions: 11035
Number of successful extensions: 52
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 52
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 52
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 63141405
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)