BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0327 (642 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 23 1.9 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 22 4.4 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/34 (29%), Positives = 19/34 (55%) Frame = +1 Query: 37 YFKIGMLNEYSNYGLFFAFNNV*LRYVKYDCTGS 138 Y++ G+L + L + F +V ++ DCTG+ Sbjct: 521 YYQRGILAKVDGQRLVYQFVDVPKDIIEIDCTGA 554 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 22.2 bits (45), Expect = 4.4 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +2 Query: 74 MAYFLLSTMFNCVMLNTIV 130 + FLL MFNCV++ + Sbjct: 603 LGLFLLLDMFNCVVVEETI 621 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,332 Number of Sequences: 438 Number of extensions: 3191 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19315974 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -