BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0325 (638 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC74.06 |mak3|phk2|histidine kinase Mak3 |Schizosaccharomyces ... 26 5.3 SPAC4G8.09 |||mitochondrial leucine-tRNA ligase|Schizosaccharomy... 25 7.0 >SPCC74.06 |mak3|phk2|histidine kinase Mak3 |Schizosaccharomyces pombe|chr 3|||Manual Length = 2344 Score = 25.8 bits (54), Expect = 5.3 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = -3 Query: 549 LPHLSNRNAMLLQGRNRRSGGTYPCGLTRGPTTSNYAN 436 L HL N L+ R +R G Y LTR T+N N Sbjct: 1721 LSHLHNPLPFELEIRIKRKDGVYRWNLTRCTPTTNEKN 1758 >SPAC4G8.09 |||mitochondrial leucine-tRNA ligase|Schizosaccharomyces pombe|chr 1|||Manual Length = 874 Score = 25.4 bits (53), Expect = 7.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +1 Query: 61 DSDRAVFRCDPSTIDWDQYL 120 D DR + C+P W QYL Sbjct: 145 DWDREISTCNPDYYKWSQYL 164 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,583,224 Number of Sequences: 5004 Number of extensions: 52536 Number of successful extensions: 110 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 107 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 110 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 285732116 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -