BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0322 (605 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g53260.1 68414.m06035 hypothetical protein low similarity to ... 44 8e-05 At3g18810.1 68416.m02389 protein kinase family protein contains ... 35 0.048 At2g39740.1 68415.m04880 expressed protein 34 0.064 At2g15690.1 68415.m01796 pentatricopeptide (PPR) repeat-containi... 33 0.19 At1g03530.1 68414.m00334 expressed protein similar to hypothetic... 32 0.26 At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associa... 32 0.34 At4g19590.1 68417.m02879 DNAJ heat shock N-terminal domain-conta... 32 0.34 At3g50580.1 68416.m05532 proline-rich family protein contains pr... 31 0.45 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 31 0.45 At1g12810.1 68414.m01488 proline-rich family protein contains pr... 31 0.59 At2g37780.1 68415.m04639 DC1 domain-containing protein contains ... 31 0.78 At5g04940.2 68418.m00523 SET domain-containing protein (SUVH1) c... 30 1.0 At5g04940.1 68418.m00522 SET domain-containing protein (SUVH1) c... 30 1.0 At4g32640.1 68417.m04646 sec23/sec24 transport protein-related 30 1.0 At4g03120.1 68417.m00425 proline-rich family protein similar to ... 30 1.0 At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid t... 30 1.0 At4g08013.1 68417.m01283 hypothetical protein low similarity to ... 30 1.4 At3g15000.1 68416.m01897 expressed protein similar to DAG protei... 30 1.4 At3g16510.1 68416.m02107 C2 domain-containing protein contains s... 29 1.8 At5g45350.1 68418.m05567 proline-rich family protein contains pr... 29 2.4 At2g18470.1 68415.m02151 protein kinase family protein contains ... 29 2.4 At5g14540.1 68418.m01704 proline-rich family protein contains pr... 29 3.2 At3g01560.1 68416.m00086 proline-rich family protein contains pr... 29 3.2 At2g29580.1 68415.m03592 zinc finger (CCCH-type) family protein ... 29 3.2 At1g34360.1 68414.m04266 translation initiation factor 3 (IF-3) ... 29 3.2 At5g59170.1 68418.m07416 proline-rich family protein contains pr... 28 4.2 At4g25520.1 68417.m03680 transcriptional co-regulator family pro... 28 4.2 At3g30520.1 68416.m03863 hypothetical protein 28 4.2 At1g33680.1 68414.m04166 KH domain-containing protein similar to... 28 4.2 At5g56250.2 68418.m07020 expressed protein 28 5.5 At5g56250.1 68418.m07019 expressed protein 28 5.5 At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associa... 28 5.5 At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associa... 28 5.5 At4g17060.1 68417.m02572 expressed protein 28 5.5 At3g24550.1 68416.m03083 protein kinase family protein contains ... 28 5.5 At3g14595.1 68416.m01848 expressed protein 28 5.5 At2g23440.1 68415.m02798 expressed protein 28 5.5 At5g18700.1 68418.m02219 protein kinase-related contains protein... 27 7.3 At5g14420.4 68418.m01687 copine-related low similarity to SP|Q99... 27 7.3 At5g14420.3 68418.m01686 copine-related low similarity to SP|Q99... 27 7.3 At5g14420.2 68418.m01685 copine-related low similarity to SP|Q99... 27 7.3 At5g14420.1 68418.m01684 copine-related low similarity to SP|Q99... 27 7.3 At1g75240.1 68414.m08741 zinc finger homeobox family protein / Z... 27 7.3 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 27 7.3 At1g07360.1 68414.m00785 zinc finger (CCCH-type) family protein ... 27 7.3 At5g13480.1 68418.m01554 WD-40 repeat family protein similar to ... 27 9.6 At3g56810.1 68416.m06318 expressed protein 27 9.6 At3g49840.1 68416.m05449 proline-rich family protein contains pr... 27 9.6 At3g22350.1 68416.m02822 F-box family protein similar to F-box p... 27 9.6 At2g45490.1 68415.m05658 protein kinase, putative contains prote... 27 9.6 At2g27380.1 68415.m03302 proline-rich family protein contains pr... 27 9.6 At1g50150.1 68414.m05624 hypothetical protein similar to hypothe... 27 9.6 At1g23540.1 68414.m02960 protein kinase family protein contains ... 27 9.6 >At1g53260.1 68414.m06035 hypothetical protein low similarity to SP|Q38732 DAG protein, chloroplast precursor {Antirrhinum majus} Length = 358 Score = 44.0 bits (99), Expect = 8e-05 Identities = 32/117 (27%), Positives = 39/117 (33%) Frame = +2 Query: 179 NVHGQFGVNQQRPPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPPNGQNGYEXXXXXX 358 N G +RPPPN + P PP+ G PP+ +PPN Y Sbjct: 181 NDRGNQDTGYRRPPPNQGMGGAPP--PPPHIGNNPNMPPH---IQPPNMNQNYRGPPPPP 235 Query: 359 XXXXXXXXXXXQNDNSNYEGPHNFGNKYPKPIYENQNNYGRPQPEFGNNNHRPTTPN 529 N N NY+GP P QN G P P + P PN Sbjct: 236 NMNQNYQGPPAPNMNQNYQGP--------PPSNMGQNYQGPPPPNMNQSYQGPPPPN 284 >At3g18810.1 68416.m02389 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 700 Score = 34.7 bits (76), Expect = 0.048 Identities = 27/111 (24%), Positives = 36/111 (32%), Gaps = 2/111 (1%) Frame = +2 Query: 206 QQRPPPNHEQIPSEPNQEPPNYGEQ-DRFPPNHNGYRPPNGQ-NGYEXXXXXXXXXXXXX 379 Q PPP+ PS P PP+ PP+ + PP+ Q N Sbjct: 27 QSSPPPSDSSSPSPPAPPPPDDSSNGSPQPPSSDSQSPPSPQGNNNNDGNNGNNNNDNNN 86 Query: 380 XXXXQNDNSNYEGPHNFGNKYPKPIYENQNNYGRPQPEFGNNNHRPTTPNH 532 N+N N G + N N N GNNN+ N+ Sbjct: 87 NNNGNNNNDNNNGNNKDNNNNGN---NNNGNNNNGNDNNGNNNNGNNNDNN 134 >At2g39740.1 68415.m04880 expressed protein Length = 474 Score = 34.3 bits (75), Expect = 0.064 Identities = 38/160 (23%), Positives = 55/160 (34%), Gaps = 5/160 (3%) Frame = +2 Query: 65 VVSECNGGLITGILSGAHDVHKQVQGAVLGGLSQAFNF----NVHGQFGVNQQRPPPNHE 232 +VSECN I GIL+G H + L A N+HGQ Q+ N Sbjct: 294 LVSECNRNSIIGILTGQHIQESLYRTISLPSQHHANGMHNVRNLHGQARPQNQQMQQNWS 353 Query: 233 QIPSEPNQEPPNYGEQDRFPPNHNGYRPPNGQNGYEXXXXXXXXXXXXXXXXXQNDNSNY 412 Q + PN PP++ + P N + N + S Y Sbjct: 354 QSYNTPN--PPHWPPLTQSRPQQNWTQ--NNPRNLQGQPPVQGQTWPVITQTQTQQKSPY 409 Query: 413 EGPHNFGNKYPKPIYENQNNYGRPQPEF-GNNNHRPTTPN 529 + + +NQ + G+P G N+ RP N Sbjct: 410 KSGNRPLKNTSAGSSQNQGHIGKPSGHMNGVNSARPAYTN 449 >At2g15690.1 68415.m01796 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 579 Score = 32.7 bits (71), Expect = 0.19 Identities = 24/79 (30%), Positives = 36/79 (45%), Gaps = 4/79 (5%) Frame = +2 Query: 107 SGAHDVHKQVQGAVLGGLSQAF---NFNVHGQFGVNQQRPPPNHEQIPSEPNQEPPNYGE 277 + A+D H+ Q + + +F+ Q NQ R P + Q ++ + P YG Sbjct: 53 AAANDYHQNPQSGSPSQHQRPYPPQSFDSQNQTNTNQ-RVPQSPNQWSTQHGGQIPQYGG 111 Query: 278 QDRFPPNHNGYRPP-NGQN 331 Q+ P H G RPP GQN Sbjct: 112 QN---PQHGGQRPPYGGQN 127 >At1g03530.1 68414.m00334 expressed protein similar to hypothetical protein GB:O14360 Length = 797 Score = 32.3 bits (70), Expect = 0.26 Identities = 21/71 (29%), Positives = 27/71 (38%), Gaps = 1/71 (1%) Frame = +2 Query: 242 SEPNQEPPNYGEQDRFPPNHNGYRP-PNGQNGYEXXXXXXXXXXXXXXXXXQNDNSNYEG 418 S+P P + D FPPN+ +RP N QN Y+ QN N Sbjct: 553 SDPQMGGPR-PQMDGFPPNNAAWRPQSNQQNPYQLPPIPNQMGMQIPFMAMQNQNQMMFQ 611 Query: 419 PHNFGNKYPKP 451 P G + P P Sbjct: 612 PQFNGGQMPMP 622 >At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|P27048 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Mus musculus} Length = 254 Score = 31.9 bits (69), Expect = 0.34 Identities = 19/49 (38%), Positives = 21/49 (42%), Gaps = 6/49 (12%) Frame = +2 Query: 206 QQRPPPNHEQIPSEPNQEPPNYGEQDR---FPP---NHNGYRPPNGQNG 334 Q PPP + P P PP YG Q R PP G PP+G G Sbjct: 170 QGGPPPPYGMRPPYPGPPPPQYGGQQRPMMIPPPGGMMRGPPPPHGMQG 218 Score = 27.9 bits (59), Expect = 5.5 Identities = 19/49 (38%), Positives = 22/49 (44%), Gaps = 4/49 (8%) Frame = +2 Query: 197 GVNQQRPPPNHEQ--IPSEPNQEPPNYGEQDRFPPNHNGY--RPPNGQN 331 G+ + PPP+ Q PS P PP G F P H G PPN N Sbjct: 205 GMMRGPPPPHGMQGPPPSRPGMPPP--GGAPMFAPPHPGMPPAPPNHHN 251 >At4g19590.1 68417.m02879 DNAJ heat shock N-terminal domain-containing protein protein YJL162c, Saccharomyces cerevisiae, PIR2:S56945; contains Pfam PF00226: DnaJ domain; Length = 345 Score = 31.9 bits (69), Expect = 0.34 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = +2 Query: 203 NQQRPPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPPN 322 NQQ+ PP+ ++ P ++PPN +Q P + +PPN Sbjct: 149 NQQKQPPDQQKQPPNQPRQPPNQQKQ----PQNEPKQPPN 184 Score = 31.9 bits (69), Expect = 0.34 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +2 Query: 203 NQQRPPPNHEQIPSEPNQEPPNYGEQDRFPPN 298 NQ R PPN ++ P ++PPN Q + PPN Sbjct: 163 NQPRQPPNQQKQPQNEPKQPPN---QPKQPPN 191 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +2 Query: 203 NQQRPPPNHEQIPSEPNQEPPNYGEQDRFPPN 298 NQ + PN ++ P + ++PPN Q R PPN Sbjct: 142 NQPKQQPNQQKQPPDQQKQPPN---QPRQPPN 170 >At3g50580.1 68416.m05532 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 265 Score = 31.5 bits (68), Expect = 0.45 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +2 Query: 215 PPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPPN 322 PPP ++ PS P+ PP + PP+H+ P N Sbjct: 135 PPPAPKKSPSTPSLPPPTPKKSPPPPPSHHSSSPSN 170 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 31.5 bits (68), Expect = 0.45 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +2 Query: 215 PPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPPNG 325 PPP+H P + PP + PP HN +PP G Sbjct: 619 PPPSHSPPPPVYSPPPPTFSP----PPTHNTNQPPMG 651 >At1g12810.1 68414.m01488 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 129 Score = 31.1 bits (67), Expect = 0.59 Identities = 16/52 (30%), Positives = 23/52 (44%), Gaps = 4/52 (7%) Frame = +2 Query: 197 GVNQQRPPPNHEQIPSEPNQ-EPPNYGEQDRFPPNHNGYRPPNG---QNGYE 340 G PPP + P P PP++ E P + GY PP+ + GY+ Sbjct: 15 GYQSHYPPPGYPSAPPPPGYPSPPSHHEGYPPPQPYGGYPPPSSRPYEGGYQ 66 >At2g37780.1 68415.m04639 DC1 domain-containing protein contains Pfam PF03107: DC1 domain Length = 286 Score = 30.7 bits (66), Expect = 0.78 Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 7/53 (13%) Frame = +2 Query: 200 VNQQRPPPNHEQIPSEPNQEP-------PNYGEQDRFPPNHNGYRPPNGQNGY 337 V +QR H PS P+Q P+ G+ + +PP GY+P N QN Y Sbjct: 121 VTKQRSLHGHAGQPSPPHQYGQGIPYGYPHMGQPEPYPPQGGGYQPQN-QNYY 172 >At5g04940.2 68418.m00523 SET domain-containing protein (SUVH1) contains Pfam profiles PF00856: SET domain, PF05033: Pre-SET motif, PF02182: YDG/SRA domain; identical to cDNA SUVH1 (SUVH1) GI:13517742 Length = 670 Score = 30.3 bits (65), Expect = 1.0 Identities = 14/48 (29%), Positives = 23/48 (47%), Gaps = 3/48 (6%) Frame = +2 Query: 200 VNQQRPPPNHEQIPSEP---NQEPPNYGEQDRFPPNHNGYRPPNGQNG 334 +NQ + PP H+Q + P Q+PP + + +R P+ NG Sbjct: 67 LNQAQYPPQHQQPQNPPPVYQQQPPQHASEPSLVTPLRSFRSPDVSNG 114 >At5g04940.1 68418.m00522 SET domain-containing protein (SUVH1) contains Pfam profiles PF00856: SET domain, PF05033: Pre-SET motif, PF02182: YDG/SRA domain; identical to cDNA SUVH1 (SUVH1) GI:13517742 Length = 670 Score = 30.3 bits (65), Expect = 1.0 Identities = 14/48 (29%), Positives = 23/48 (47%), Gaps = 3/48 (6%) Frame = +2 Query: 200 VNQQRPPPNHEQIPSEP---NQEPPNYGEQDRFPPNHNGYRPPNGQNG 334 +NQ + PP H+Q + P Q+PP + + +R P+ NG Sbjct: 67 LNQAQYPPQHQQPQNPPPVYQQQPPQHASEPSLVTPLRSFRSPDVSNG 114 >At4g32640.1 68417.m04646 sec23/sec24 transport protein-related Length = 1069 Score = 30.3 bits (65), Expect = 1.0 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = +2 Query: 212 RPPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPPNG 325 RPPP Q P Q+ P+YG R P + PP G Sbjct: 56 RPPPPFGQSPQPFPQQSPSYGAPQRGPSPMSRPGPPAG 93 >At4g03120.1 68417.m00425 proline-rich family protein similar to U1 small nuclear ribonucleoprotein C; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 207 Score = 30.3 bits (65), Expect = 1.0 Identities = 15/37 (40%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +2 Query: 218 PPNHEQIPSEPNQEPPNYGEQDRFPPNH-NGYRPPNG 325 PP IP + PPNY PP H N PP+G Sbjct: 150 PPGMAPIPGQGGGPPPNYNGLPPPPPYHTNPAAPPSG 186 >At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to auxin down regulated GB:X69640 GI:296442 from [Glycine max]; contains Pfam profile PF00234: Protease inhibitor/seed storage/LTP family Length = 297 Score = 30.3 bits (65), Expect = 1.0 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +2 Query: 185 HGQFGVNQQRPPPNHEQIPSEPNQEPPNYGEQDRFPPNHNG 307 HG G +PPP+H + +PP +G + PP+H G Sbjct: 43 HGGGGGGGSKPPPHHG---GKGGGKPPPHGGKGGGPPHHGG 80 >At4g08013.1 68417.m01283 hypothetical protein low similarity to SCARECROW [Zea mays] GI:10178637 Length = 113 Score = 29.9 bits (64), Expect = 1.4 Identities = 15/39 (38%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = +2 Query: 215 PPPNHEQIPSEPNQEPPNYGEQDRFP-PNHNGYRPPNGQ 328 PPP E+ P E P EQ P PN Y P+ Q Sbjct: 57 PPPRSEEAQFNPPPEAPLNQEQSESPNPNSQAYTHPSSQ 95 >At3g15000.1 68416.m01897 expressed protein similar to DAG protein (required for chloroplast differentiation and palisade development) GB:Q38732 [Antirrhinum majus] Length = 395 Score = 29.9 bits (64), Expect = 1.4 Identities = 27/112 (24%), Positives = 37/112 (33%) Frame = +2 Query: 149 LGGLSQAFNFNVHGQFGVNQQRPPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPPNGQ 328 +GG + Q + RPP N+ P PPNYG P N+ G PP Sbjct: 289 MGGPRHPPPYGAPPQNNMGGPRPPQNYGGTP------PPNYGGAP--PANNMGGAPPPNY 340 Query: 329 NGYEXXXXXXXXXXXXXXXXXQNDNSNYEGPHNFGNKYPKPIYENQNNYGRP 484 G QN+N +G +Y N++ G P Sbjct: 341 GGGPPPQYGAVPPPQYGGAPPQNNNYQQQGSGMQQPQYQNNYPPNRDGSGNP 392 >At3g16510.1 68416.m02107 C2 domain-containing protein contains similarity to shock protein SRC2 [Glycine max] gi|2055230|dbj|BAA19769 ; contains Pfam profile PF00168:C2 domain Length = 360 Score = 29.5 bits (63), Expect = 1.8 Identities = 29/103 (28%), Positives = 38/103 (36%), Gaps = 2/103 (1%) Frame = +2 Query: 215 PPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPPNGQNGYEXXXXXXXXXXXXXXXXXQ 394 PPP PS N PP Y PP H Y PP G + ++ Sbjct: 244 PPP-----PSASNLYPPPYYSTS--PPQHQSYPPPPGHSFHQTQPSQSFHGFAP------ 290 Query: 395 NDNSNYEGPHNFGNKYPKPIYENQNNYGRPQPEF--GNNNHRP 517 S+ + H +G YP P YG P + NNN++P Sbjct: 291 ---SSPQNQHGYG--YPPPTSPGY-GYGCPTTQVPPKNNNNKP 327 >At5g45350.1 68418.m05567 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 177 Score = 29.1 bits (62), Expect = 2.4 Identities = 15/43 (34%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = +2 Query: 215 PPPNHEQ--IPSEPNQEPPNYGEQDRFPPNHNGYRPPNGQNGY 337 PP + Q P P PP +PP GY P G GY Sbjct: 28 PPAGYPQQGYPPPPGAYPPAGYPPGAYPPAPGGYPPAPGYGGY 70 >At2g18470.1 68415.m02151 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 633 Score = 29.1 bits (62), Expect = 2.4 Identities = 15/48 (31%), Positives = 19/48 (39%), Gaps = 2/48 (4%) Frame = +2 Query: 197 GVNQQRPPPNHEQIPSEPNQEPPNYGEQDRFPPNH--NGYRPPNGQNG 334 G + PPP+ P+ PPN PP+ G R G NG Sbjct: 43 GDSSSSPPPDSTSPPAPQAPNPPNSSNNSPSPPSQGGGGERGNGGNNG 90 >At5g14540.1 68418.m01704 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 547 Score = 28.7 bits (61), Expect = 3.2 Identities = 12/48 (25%), Positives = 20/48 (41%) Frame = +2 Query: 197 GVNQQRPPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPPNGQNGYE 340 G N + PP + P P ++PP++ P PP + Y+ Sbjct: 350 GYNPEEPPYPQQSYPPNPPRQPPSHPPPGSAPSQQYYNAPPTPPSMYD 397 Score = 27.9 bits (59), Expect = 5.5 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = +2 Query: 209 QRPPPNHEQIPSEPNQEPPNYGEQDRFPPN 298 Q+PPP + PS N E P Y +Q +PPN Sbjct: 339 QQPPPQLQH-PSGYNPEEPPYPQQS-YPPN 366 >At3g01560.1 68416.m00086 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 511 Score = 28.7 bits (61), Expect = 3.2 Identities = 17/51 (33%), Positives = 21/51 (41%), Gaps = 2/51 (3%) Frame = +2 Query: 191 QFGVNQQR--PPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPPNGQNGY 337 QF Q+ PPP+H P P PP Y P+ Y+ P Q Y Sbjct: 278 QFSSQQEPYCPPPSH---PQPPPSNPPPYQAPQTQTPHQPSYQSPPQQPQY 325 Score = 27.5 bits (58), Expect = 7.3 Identities = 14/38 (36%), Positives = 19/38 (50%), Gaps = 4/38 (10%) Frame = +2 Query: 215 PPPNHE---QIPSEPN-QEPPNYGEQDRFPPNHNGYRP 316 PPP Q P +P+ Q PP + + PP +GY P Sbjct: 300 PPPYQAPQTQTPHQPSYQSPPQQPQYPQQPPPSSGYNP 337 >At2g29580.1 68415.m03592 zinc finger (CCCH-type) family protein / RNA recognition motif (RRM)-containing protein similar to SP|O59800 Cell cycle control protein cwf5 {Schizosaccharomyces pombe}; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 483 Score = 28.7 bits (61), Expect = 3.2 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = +2 Query: 152 GGLSQAFNFNVHGQFGVNQQRPPPNHEQIPSEPNQEPPNY 271 G S ++ HG + +Q PPP++ P Q+ P Y Sbjct: 384 GASSSSYTMPPHGHYPQHQPYPPPSYGGYMQPPYQQYPPY 423 >At1g34360.1 68414.m04266 translation initiation factor 3 (IF-3) family protein low similarity to Translation initiation factor IF-3 from [subsp. Schizaphis graminum] {Buchnera aphidicola} SP|P46243, {Salmonella typhimurium} SP|P33321; contains Pfam profiles PF05198: Translation initiation factor IF-3 N-terminal domain, PF00707: Translation initiation factor IF-3 C-terminal domain Length = 520 Score = 28.7 bits (61), Expect = 3.2 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +2 Query: 443 PKPIYENQNNYGRPQPEFGNNNHRPTTPN 529 P+P + NQ GR P+F + RP PN Sbjct: 376 PRPQFPNQQPTGRFDPQFPSQPPRPQFPN 404 >At5g59170.1 68418.m07416 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 288 Score = 28.3 bits (60), Expect = 4.2 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +2 Query: 206 QQRPPPNHEQIPSEPNQEP-PNYGEQDRFPPNHNGYRPP 319 +Q PPP + P E P Y Q+++PP Y PP Sbjct: 144 EQYPPPIKKYPPPEHYPPPIKKYPPQEQYPPPIKKYPPP 182 >At4g25520.1 68417.m03680 transcriptional co-regulator family protein contains similarity to GP|18033922|gb|AAL57277 SEUSS transcriptional co-regulator [Arabidopsis thaliana] Length = 748 Score = 28.3 bits (60), Expect = 4.2 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +2 Query: 173 NFNVHGQFGVNQQRPPPNHEQIPSEPNQEPPN 268 N N Q G + Q P PN Q PS +Q+ N Sbjct: 578 NSNTGKQEGFSSQNPTPNSNQSPSSSSQQRHN 609 >At3g30520.1 68416.m03863 hypothetical protein Length = 397 Score = 28.3 bits (60), Expect = 4.2 Identities = 18/46 (39%), Positives = 22/46 (47%), Gaps = 4/46 (8%) Frame = +2 Query: 212 RPPPNHEQIPSEPN----QEPPNYGEQDRFPPNHNGYRPPNGQNGY 337 R PPN Q + PN + PPN PPN +G P N Q G+ Sbjct: 296 RTPPNVAQWGTPPNVAQCRTPPNAPHWGT-PPNAHGTTPTNVQYGF 340 >At1g33680.1 68414.m04166 KH domain-containing protein similar to FUSE binding protein 2 GB:AAC50892 GI:1575607 from [Homo sapiens] Length = 759 Score = 28.3 bits (60), Expect = 4.2 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = +2 Query: 215 PPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPPNGQNGY 337 PP + P P+ P NY +P + +RPPN GY Sbjct: 411 PPQWGSRGPHGPHSMPYNYHHGGPYPSQGSHFRPPN-SGGY 450 >At5g56250.2 68418.m07020 expressed protein Length = 811 Score = 27.9 bits (59), Expect = 5.5 Identities = 13/46 (28%), Positives = 21/46 (45%) Frame = +2 Query: 200 VNQQRPPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPPNGQNGY 337 V QR P+H + +P + + + + P+ N PP NGY Sbjct: 755 VINQREEPSHNESSPKPTSQFLDLSKTQQASPSVNLLHPPYSGNGY 800 >At5g56250.1 68418.m07019 expressed protein Length = 811 Score = 27.9 bits (59), Expect = 5.5 Identities = 13/46 (28%), Positives = 21/46 (45%) Frame = +2 Query: 200 VNQQRPPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPPNGQNGY 337 V QR P+H + +P + + + + P+ N PP NGY Sbjct: 755 VINQREEPSHNESSPKPTSQFLDLSKTQQASPSVNLLHPPYSGNGY 800 >At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 27.9 bits (59), Expect = 5.5 Identities = 17/45 (37%), Positives = 21/45 (46%), Gaps = 4/45 (8%) Frame = +2 Query: 212 RPPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYR----PPNGQNG 334 RPPP +Q P PP YG++ PP R PP+G G Sbjct: 189 RPPP--QQFSGPP---PPQYGQRPMIPPPGGMMRGPPPPPHGMQG 228 >At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 27.9 bits (59), Expect = 5.5 Identities = 17/45 (37%), Positives = 21/45 (46%), Gaps = 4/45 (8%) Frame = +2 Query: 212 RPPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYR----PPNGQNG 334 RPPP +Q P PP YG++ PP R PP+G G Sbjct: 189 RPPP--QQFSGPP---PPQYGQRPMIPPPGGMMRGPPPPPHGMQG 228 >At4g17060.1 68417.m02572 expressed protein Length = 310 Score = 27.9 bits (59), Expect = 5.5 Identities = 16/55 (29%), Positives = 23/55 (41%) Frame = +2 Query: 173 NFNVHGQFGVNQQRPPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPPNGQNGY 337 NF HG N +P PN Q ++ + E++ F P R + NGY Sbjct: 146 NFASHGFKPKNFSKPEPNFSQDLDYDDEFDDDRAEREGFNPRIQSSRSSSRVNGY 200 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 27.9 bits (59), Expect = 5.5 Identities = 14/40 (35%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = +2 Query: 221 PNHEQIPSEPNQEPPN--YGEQDRFPPNHNGYRPPNGQNG 334 P++ + P PNQ PPN G R P N P + +G Sbjct: 96 PSNPRSPPSPNQGPPNTPSGSTPRTPSNTKPSPPSDSSDG 135 >At3g14595.1 68416.m01848 expressed protein Length = 132 Score = 27.9 bits (59), Expect = 5.5 Identities = 13/37 (35%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = +2 Query: 203 NQQRPPPNHEQIPS-EPNQEPPNYGEQDRFPPNHNGY 310 +QQ+PPP + + + P Q+PP G P GY Sbjct: 18 HQQQPPPPFQGVSNYPPQQQPPATGYPQPAQPYAQGY 54 >At2g23440.1 68415.m02798 expressed protein Length = 82 Score = 27.9 bits (59), Expect = 5.5 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +2 Query: 239 PSEPNQEPPNYGEQDRFPPNHNGYRPPNGQN 331 P+EP + PP++G D F P G+ P G + Sbjct: 50 PTEPLESPPSHG-VDTFRPTEPGHSPGIGHS 79 >At5g18700.1 68418.m02219 protein kinase-related contains protein kinase domain, INTERPRO:IPR000719 Length = 1366 Score = 27.5 bits (58), Expect = 7.3 Identities = 15/48 (31%), Positives = 22/48 (45%) Frame = +2 Query: 197 GVNQQRPPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPPNGQNGYE 340 G+N + P E+ PN+ PP Y E+DR + G G+E Sbjct: 273 GINTK--PCLSERNGDRPNKTPPKYREKDRKGGSKQNENSIQGSKGHE 318 >At5g14420.4 68418.m01687 copine-related low similarity to SP|Q99829 Copine I {Homo sapiens} Length = 468 Score = 27.5 bits (58), Expect = 7.3 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +2 Query: 215 PPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPPNGQNG 334 PPP++ Q P PP Y Q P+++ PP+ G Sbjct: 48 PPPSYAQPPEYTQPPPPLYSTQPYSAPSYSA--PPSQSYG 85 >At5g14420.3 68418.m01686 copine-related low similarity to SP|Q99829 Copine I {Homo sapiens} Length = 468 Score = 27.5 bits (58), Expect = 7.3 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +2 Query: 215 PPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPPNGQNG 334 PPP++ Q P PP Y Q P+++ PP+ G Sbjct: 48 PPPSYAQPPEYTQPPPPLYSTQPYSAPSYSA--PPSQSYG 85 >At5g14420.2 68418.m01685 copine-related low similarity to SP|Q99829 Copine I {Homo sapiens} Length = 468 Score = 27.5 bits (58), Expect = 7.3 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +2 Query: 215 PPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPPNGQNG 334 PPP++ Q P PP Y Q P+++ PP+ G Sbjct: 48 PPPSYAQPPEYTQPPPPLYSTQPYSAPSYSA--PPSQSYG 85 >At5g14420.1 68418.m01684 copine-related low similarity to SP|Q99829 Copine I {Homo sapiens} Length = 468 Score = 27.5 bits (58), Expect = 7.3 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +2 Query: 215 PPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPPNGQNG 334 PPP++ Q P PP Y Q P+++ PP+ G Sbjct: 48 PPPSYAQPPEYTQPPPPLYSTQPYSAPSYSA--PPSQSYG 85 >At1g75240.1 68414.m08741 zinc finger homeobox family protein / ZF-HD homeobox family protein Length = 309 Score = 27.5 bits (58), Expect = 7.3 Identities = 23/91 (25%), Positives = 36/91 (39%), Gaps = 13/91 (14%) Frame = +2 Query: 86 GLITGILSGAHDVHKQVQGAVLGGL--SQAFNFNVHGQFGVNQ------QRPPP-----N 226 G I + A D H+ + G+ S + + H + NQ +RPPP N Sbjct: 105 GTIEALRCAACDCHRNFHRKEMDGVGSSDLISHHRHHHYHHNQYGGGGGRRPPPPNMMLN 164 Query: 227 HEQIPSEPNQEPPNYGEQDRFPPNHNGYRPP 319 +P PN +P ++ + PP G P Sbjct: 165 PLMLPPPPNYQPIHHHKYGMSPPGGGGMVTP 195 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 27.5 bits (58), Expect = 7.3 Identities = 14/34 (41%), Positives = 16/34 (47%), Gaps = 4/34 (11%) Frame = +2 Query: 206 QQRPPPNHEQIPSE----PNQEPPNYGEQDRFPP 295 Q PPP +EQ PS P+ PP Y PP Sbjct: 576 QSPPPPKYEQTPSPREYYPSPSPPYYQYTSSPPP 609 Score = 27.5 bits (58), Expect = 7.3 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +2 Query: 215 PPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPP 319 PPP + S P PP Y PP Y PP Sbjct: 608 PPPTYYATQSPPPPPPPTYYAVQSPPPPPPVYYPP 642 >At1g07360.1 68414.m00785 zinc finger (CCCH-type) family protein / RNA recognition motif (RRM)-containing protein similar to SP|O59800 Cell cycle control protein cwf5 {Schizosaccharomyces pombe}, RNA Binding Protein 47 [Nicotiana plumbaginifolia] GI:9663769; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 481 Score = 27.5 bits (58), Expect = 7.3 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +2 Query: 203 NQQRPPPNHEQIPSEPNQE-PPNYGEQDRFPPNHNGYRPP 319 +Q PPP + +PS Q+ PPN+ Q P H Y PP Sbjct: 389 HQSYPPPPYGYMPSPYQQQYPPNHHHQPS-PMQH--YAPP 425 >At5g13480.1 68418.m01554 WD-40 repeat family protein similar to WD-repeat protein WDC146 (SP:Q9C0J8|) {Homo sapiens}; contains 3 weak Pfam PF00400: WD domain, G-beta repeats; Length = 711 Score = 27.1 bits (57), Expect = 9.6 Identities = 15/49 (30%), Positives = 19/49 (38%) Frame = +2 Query: 191 QFGVNQQRPPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPPNGQNGY 337 Q G+N Q + PS Q PN G +P G+ P GY Sbjct: 638 QGGMNPQMSQSHFMGAPSGVFQGQPNSGGPQMYPQGRGGFNRPQMIPGY 686 >At3g56810.1 68416.m06318 expressed protein Length = 332 Score = 27.1 bits (57), Expect = 9.6 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +1 Query: 34 EKKNRNLCSISSQ*MQWWANYRYPQRGSRCAQTSAGC 144 + K NL S SS W N+ P+R S + S+GC Sbjct: 3 KSKRENLLSPSSS---WRENHNPPRRNSNSSAVSSGC 36 >At3g49840.1 68416.m05449 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 606 Score = 27.1 bits (57), Expect = 9.6 Identities = 16/46 (34%), Positives = 18/46 (39%) Frame = +2 Query: 191 QFGVNQQRPPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPPNGQ 328 Q G Q P + P P PP Y Q PP H G PP + Sbjct: 536 QQGYGQGYPAQGYPP-PQYPQGHPPQYPYQGP-PPPHYGQAPPKNK 579 >At3g22350.1 68416.m02822 F-box family protein similar to F-box protein family, AtFBX9 (GI:20197985) [Arabidopsis thaliana]; contains Pfam PF00646: F-box domain; contains TIGRFAM TIGR01640 : F-box protein interaction domain Length = 378 Score = 27.1 bits (57), Expect = 9.6 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = -2 Query: 262 WFLIRFARYLFMVWWWSLLIHAKLSMYVEV 173 W+L RF+ WWW I+ + V++ Sbjct: 348 WWLCRFSEKFTKKWWWFPFIYNYVPSLVQI 377 >At2g45490.1 68415.m05658 protein kinase, putative contains protein kinase domain, Pfam:PF00069; similar to protein kinase p46XlEg22 [Xenopus laevis] gi|609280|emb|CAA78914 Length = 288 Score = 27.1 bits (57), Expect = 9.6 Identities = 14/57 (24%), Positives = 28/57 (49%) Frame = +2 Query: 56 VLLVVSECNGGLITGILSGAHDVHKQVQGAVLGGLSQAFNFNVHGQFGVNQQRPPPN 226 + L++ +GG + G+L + +Q + LSQA + HG+ +++ P N Sbjct: 95 IFLILEYAHGGELYGVLKQNGHLTEQQAATYIASLSQALAY-CHGKCVIHRDIKPEN 150 >At2g27380.1 68415.m03302 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 761 Score = 27.1 bits (57), Expect = 9.6 Identities = 14/41 (34%), Positives = 17/41 (41%) Frame = +2 Query: 212 RPPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPPNGQNG 334 +PPP Q+P P PP + PP PP G G Sbjct: 707 KPPP--VQVPPTPTYSPPIKPPPVQVPPTPTTPSPPQGGYG 745 >At1g50150.1 68414.m05624 hypothetical protein similar to hypothetical protein GB:AAD50048 GI:5734783 from [Arabidopsis thaliana] Length = 358 Score = 27.1 bits (57), Expect = 9.6 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +2 Query: 173 NFNVHGQFGVNQQRPPPNHEQIPSEPNQEPPNYGEQDR 286 +F+ H Q GV Q N+E+ SE +E P +++R Sbjct: 98 HFDSHAQLGVQDQIEWLNNEKRASESRKESPFLNKRER 135 >At1g23540.1 68414.m02960 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 720 Score = 27.1 bits (57), Expect = 9.6 Identities = 13/40 (32%), Positives = 17/40 (42%), Gaps = 5/40 (12%) Frame = +2 Query: 215 PPPNHEQIPSEPNQE-----PPNYGEQDRFPPNHNGYRPP 319 PPP + PS P PPN + PP+ + PP Sbjct: 95 PPPTSNESPSPPEDSETPPAPPNESNDNNPPPSQDLQSPP 134 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,194,079 Number of Sequences: 28952 Number of extensions: 273829 Number of successful extensions: 1104 Number of sequences better than 10.0: 53 Number of HSP's better than 10.0 without gapping: 902 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1074 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1206913392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -