BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0319 (707 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 28 0.065 EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 22 5.6 AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory recept... 22 5.6 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 28.3 bits (60), Expect = 0.065 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = -3 Query: 621 RNNFSIRYWSWNYRGCWHQTC 559 R+NF + WNY CW C Sbjct: 746 RHNFKGLHLDWNYPVCWQSNC 766 Score = 23.4 bits (48), Expect = 1.8 Identities = 8/25 (32%), Positives = 9/25 (36%) Frame = -3 Query: 633 ELFNRNNFSIRYWSWNYRGCWHQTC 559 + NNF W Y CW C Sbjct: 1930 DFIETNNFDGLDLDWEYPKCWQVDC 1954 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 21.8 bits (44), Expect = 5.6 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = -1 Query: 311 RHLKDASPVLDHAICKSYPDSSKLTTSDARP 219 RH+K A PV+ + C S++L P Sbjct: 68 RHIKGAIPVVSLSTCSMLCGSTQLWPQPTGP 98 >AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory receptor candidate 33 protein. Length = 321 Score = 21.8 bits (44), Expect = 5.6 Identities = 5/16 (31%), Positives = 9/16 (56%) Frame = -3 Query: 612 FSIRYWSWNYRGCWHQ 565 +++ YW Y WH+ Sbjct: 117 YAVYYWRQQYEDFWHR 132 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,467 Number of Sequences: 336 Number of extensions: 3531 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18738900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -