BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0319 (707 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF099925-14|AAX55690.1| 679|Caenorhabditis elegans Calcium bind... 28 7.5 AF077545-1|AAC26306.2| 506|Caenorhabditis elegans Hypothetical ... 28 7.5 AF038611-7|AAB92040.1| 466|Caenorhabditis elegans Hypothetical ... 28 7.5 Z81588-2|CAB04712.1| 379|Caenorhabditis elegans Hypothetical pr... 27 9.9 Z81579-4|CAE17915.1| 212|Caenorhabditis elegans Hypothetical pr... 27 9.9 Z66494-3|CAA91258.2| 520|Caenorhabditis elegans Hypothetical pr... 27 9.9 >AF099925-14|AAX55690.1| 679|Caenorhabditis elegans Calcium binding protein homologprotein 1, isoform d protein. Length = 679 Score = 27.9 bits (59), Expect = 7.5 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -1 Query: 431 LPSLDVVAVSQAPSPESNPDSPLPVTTMVVAETTI 327 +P+ V+ ++ PS +S + VTT V+ TTI Sbjct: 559 VPTTTVIQTTETPSTKSKTTKKVKVTTTTVSTTTI 593 >AF077545-1|AAC26306.2| 506|Caenorhabditis elegans Hypothetical protein H41C03.3 protein. Length = 506 Score = 27.9 bits (59), Expect = 7.5 Identities = 14/40 (35%), Positives = 16/40 (40%) Frame = -3 Query: 702 CSANVSVSPRMRCTDSAAHKCNYELFNRNNFSIRYWSWNY 583 C NV + P DSA H N +N I WNY Sbjct: 211 CLPNVLLLPDEESVDSAGHNINLAHYNCLRVLINKPGWNY 250 >AF038611-7|AAB92040.1| 466|Caenorhabditis elegans Hypothetical protein E04A4.6 protein. Length = 466 Score = 27.9 bits (59), Expect = 7.5 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = +3 Query: 66 DTANGSIYQFWFLRSYSVTWITVVILELIHAIRTL 170 D+ G++ WF +++SV WI +V+ I +T+ Sbjct: 224 DSLPGNVDNNWFEQTFSVYWIPLVVASEIETNQTV 258 >Z81588-2|CAB04712.1| 379|Caenorhabditis elegans Hypothetical protein T07D10.2 protein. Length = 379 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -2 Query: 448 GNLRACCLPWMW*PFLRLPLR 386 GNL +C PW+W F R L+ Sbjct: 330 GNLNSCMNPWLWFHFNRKQLK 350 >Z81579-4|CAE17915.1| 212|Caenorhabditis elegans Hypothetical protein R13H4.8 protein. Length = 212 Score = 27.5 bits (58), Expect = 9.9 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +3 Query: 615 CCG*KARSCICAPRCRC 665 CCG C C PRC C Sbjct: 79 CCGCGCGCCCCRPRCCC 95 >Z66494-3|CAA91258.2| 520|Caenorhabditis elegans Hypothetical protein C34C6.3 protein. Length = 520 Score = 27.5 bits (58), Expect = 9.9 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +3 Query: 108 SYSVTWITVVILELIHAIRTLTSDGMS 188 SY+V+WIT + IR + SDG++ Sbjct: 54 SYNVSWITPAASNSTYRIRLIDSDGLT 80 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,136,144 Number of Sequences: 27780 Number of extensions: 333233 Number of successful extensions: 939 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 810 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 933 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1645110168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -