BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0316 (706 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC22F8.08 |||COPII vesicle coat protein |Schizosaccharomyces p... 29 0.65 SPAC13G6.12c |chs1|SPAC24B11.01c|chitin synthase I|Schizosacchar... 27 2.0 >SPAC22F8.08 |||COPII vesicle coat protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 926 Score = 29.1 bits (62), Expect = 0.65 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -1 Query: 655 FSLVVSNDHRYSCEDCG 605 FS+ + N HRY C CG Sbjct: 266 FSIFIDNGHRYRCNSCG 282 >SPAC13G6.12c |chs1|SPAC24B11.01c|chitin synthase I|Schizosaccharomyces pombe|chr 1|||Manual Length = 859 Score = 27.5 bits (58), Expect = 2.0 Identities = 14/54 (25%), Positives = 27/54 (50%) Frame = -3 Query: 314 GWITGKKFQSDSHNISKTQFNSLTAVSRSNVTMN*IKLIITIICCYRLIAHITV 153 GWI + HN S T + +A+ SNV +N ++I++ Y + +++ Sbjct: 631 GWIAYRAISDAIHNASSTSSSYTSALLNSNVFIN---IVISLSSTYGMYLVVSI 681 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,531,894 Number of Sequences: 5004 Number of extensions: 43734 Number of successful extensions: 126 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 120 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 126 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 327172622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -