BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0316 (706 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z66494-12|CAE17686.1| 1007|Caenorhabditis elegans Hypothetical p... 27 9.9 Z66494-11|CAA91265.2| 1048|Caenorhabditis elegans Hypothetical p... 27 9.9 Z54284-8|CAE17775.1| 1007|Caenorhabditis elegans Hypothetical pr... 27 9.9 Z54284-7|CAA91065.2| 1048|Caenorhabditis elegans Hypothetical pr... 27 9.9 >Z66494-12|CAE17686.1| 1007|Caenorhabditis elegans Hypothetical protein D2085.5b protein. Length = 1007 Score = 27.5 bits (58), Expect = 9.9 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = +2 Query: 419 GRSTLLPYILLKYSKLRLRRNRILLHFASSPCGSFRRRCLR-LSSILTIRTT 571 G +LLP+ L + + +++ LH + S RR CLR LSS++ TT Sbjct: 129 GIESLLPHFLFALDIVMIESSKLRLHPSISEV-EVRRACLRALSSVICWPTT 179 >Z66494-11|CAA91265.2| 1048|Caenorhabditis elegans Hypothetical protein D2085.5a protein. Length = 1048 Score = 27.5 bits (58), Expect = 9.9 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = +2 Query: 419 GRSTLLPYILLKYSKLRLRRNRILLHFASSPCGSFRRRCLR-LSSILTIRTT 571 G +LLP+ L + + +++ LH + S RR CLR LSS++ TT Sbjct: 170 GIESLLPHFLFALDIVMIESSKLRLHPSISEV-EVRRACLRALSSVICWPTT 220 >Z54284-8|CAE17775.1| 1007|Caenorhabditis elegans Hypothetical protein D2085.5b protein. Length = 1007 Score = 27.5 bits (58), Expect = 9.9 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = +2 Query: 419 GRSTLLPYILLKYSKLRLRRNRILLHFASSPCGSFRRRCLR-LSSILTIRTT 571 G +LLP+ L + + +++ LH + S RR CLR LSS++ TT Sbjct: 129 GIESLLPHFLFALDIVMIESSKLRLHPSISEV-EVRRACLRALSSVICWPTT 179 >Z54284-7|CAA91065.2| 1048|Caenorhabditis elegans Hypothetical protein D2085.5a protein. Length = 1048 Score = 27.5 bits (58), Expect = 9.9 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = +2 Query: 419 GRSTLLPYILLKYSKLRLRRNRILLHFASSPCGSFRRRCLR-LSSILTIRTT 571 G +LLP+ L + + +++ LH + S RR CLR LSS++ TT Sbjct: 170 GIESLLPHFLFALDIVMIESSKLRLHPSISEV-EVRRACLRALSSVICWPTT 220 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,448,082 Number of Sequences: 27780 Number of extensions: 258763 Number of successful extensions: 867 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 799 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 867 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1634564590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -