BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0316 (706 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g11970.1 68418.m01400 expressed protein 29 3.0 At4g32820.1 68417.m04668 expressed protein ; expression supporte... 29 4.0 At1g53650.1 68414.m06105 RNA-binding protein, putative similar t... 28 6.9 >At5g11970.1 68418.m01400 expressed protein Length = 105 Score = 29.1 bits (62), Expect = 3.0 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = +1 Query: 574 MQP-HGNERASFRSLRKNIGGRWKRLVKKKPEQEVTRSR 687 +QP HGN+ FRS + G R + K E+ + RS+ Sbjct: 17 IQPYHGNQGGDFRSYSASYGTRENNIYDVKKEKSIARSK 55 >At4g32820.1 68417.m04668 expressed protein ; expression supported by MPSS Length = 1817 Score = 28.7 bits (61), Expect = 4.0 Identities = 14/64 (21%), Positives = 31/64 (48%) Frame = +1 Query: 253 LNCVLEML*LSDWNFLPVIQPSVFDYSCVNGPFETMVGNNGTMMAIRIVHSKLRKREEHS 432 L+C + +L +S W F + S +++C+ E ++ + + + + LR HS Sbjct: 126 LSCSMGLLSISRWAFEQGLLCSPNNWNCMEKLLEVLIAVGDEVSCLSVANLILRHWPSHS 185 Query: 433 ASVH 444 ++H Sbjct: 186 RALH 189 >At1g53650.1 68414.m06105 RNA-binding protein, putative similar to RNA-binding protein GB:AAA86641 GI:1174153 from [Arabidopsis thaliana] Length = 314 Score = 27.9 bits (59), Expect = 6.9 Identities = 17/46 (36%), Positives = 21/46 (45%) Frame = -3 Query: 182 CYRLIAHITVRRNAREDRVTRAFSCAIGD*NFIEKCGRQVPSKALA 45 C R I V +NA ED V F A G+ + G QV S +A Sbjct: 223 CSRTIYCTNVDKNATEDDVNTFFQSACGEVTRLRLLGDQVHSTRIA 268 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,620,656 Number of Sequences: 28952 Number of extensions: 239913 Number of successful extensions: 646 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 627 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 646 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1516419560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -