BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0311 (676 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A7FT14 Cluster: Conserved domain protein; n=4; Clostrid... 33 4.8 UniRef50_Q0W4G2 Cluster: Putative uncharacterized protein; n=1; ... 33 8.4 >UniRef50_A7FT14 Cluster: Conserved domain protein; n=4; Clostridium botulinum|Rep: Conserved domain protein - Clostridium botulinum (strain ATCC 19397 / Type A) Length = 259 Score = 33.5 bits (73), Expect = 4.8 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = -3 Query: 545 HMLTSSINEKYKRWDKRVSKKDSYNWND 462 H + S+N+K W +++SK+ NW+D Sbjct: 84 HTINKSLNQKIYMWSRKISKEGMINWSD 111 >UniRef50_Q0W4G2 Cluster: Putative uncharacterized protein; n=1; uncultured methanogenic archaeon RC-I|Rep: Putative uncharacterized protein - Uncultured methanogenic archaeon RC-I Length = 742 Score = 32.7 bits (71), Expect = 8.4 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = -3 Query: 572 STYLPI*YTHMLTSSINEKYKRWDKRVSKKDSYNWNDCTCYII 444 S Y+P+ + + I+ K RWD SYNW+D Y++ Sbjct: 639 SGYIPVYSDYYRSLLISGKNGRWDYTSGGITSYNWSDANIYVL 681 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 529,723,125 Number of Sequences: 1657284 Number of extensions: 9069991 Number of successful extensions: 19960 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 19333 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19955 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 52066120554 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -