BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0303 (663 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_10931| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_39285| Best HMM Match : Proteasome (HMM E-Value=0) 36 0.022 SB_48652| Best HMM Match : RVT_1 (HMM E-Value=0.0009) 36 0.029 SB_50062| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_22053| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_28327| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_50916| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_8505| Best HMM Match : CitD (HMM E-Value=0.91) 28 7.8 >SB_10931| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 467 Score = 50.4 bits (115), Expect = 1e-06 Identities = 30/102 (29%), Positives = 53/102 (51%), Gaps = 2/102 (1%) Frame = +3 Query: 219 GTTIVGIIYADGVILGADTRATENTVVSDKNCQKIHYLASNMYCCG--AGTAADTEMTTQ 392 GTT + + GVI+ D+RAT + ++ + +K+ + N Y G AG AAD + Sbjct: 28 GTTTLAFKFKHGVIVAVDSRATAGSYIASQTVKKV--IEINPYLLGTMAGGAADCSFWER 85 Query: 393 SVASQLELQRLHTGRTVPVETAATLLKRMLFRYQGHIGAALV 518 +A Q + L + V A+ +L M++ Y+G +G ++V Sbjct: 86 LLAKQCRIYELRNKERISVAAASKILANMVYYYKG-MGLSMV 126 Score = 34.3 bits (75), Expect = 0.090 Identities = 20/62 (32%), Positives = 33/62 (53%) Frame = +3 Query: 477 MLFRYQGHIGAALVLGGVDRTGPHIYCIYPHGSVDKLPYATMGSGSLAAMAVFEAGWKRD 656 M F +QG ++ G D+ GP +Y + G+ ++GSGS A V ++G+K D Sbjct: 146 MFFTFQG-----TMICGWDKKGPGLYYVDSDGTRLSNQMFSVGSGSTYAYGVMDSGYKYD 200 Query: 657 MN 662 M+ Sbjct: 201 MS 202 >SB_39285| Best HMM Match : Proteasome (HMM E-Value=0) Length = 215 Score = 36.3 bits (80), Expect = 0.022 Identities = 36/155 (23%), Positives = 63/155 (40%), Gaps = 6/155 (3%) Frame = +3 Query: 198 APKATKTGTTIVGIIYADGVILGADTRATENTVVSDKNCQKIHYLASNMYCCGAGTAADT 377 A +A K G+T VG+ + V+LG + +A + + +KI L ++ AG AD Sbjct: 24 AQEAVKKGSTAVGVRGNNIVVLGVERKAVAK-LQEPRTVRKICTLDDHVLMAFAGLTADA 82 Query: 378 EMTTQSVASQLELQRLHTGRTVPVETAATLLKRMLFRY-----QGHIGAALVLGGVDRTG 542 + + + +L V +E + + RY + G + ++ G D G Sbjct: 83 RILVNKARVECQSHKLTVEDPVTLEYITRFIATLKQRYTQSNGRRPFGISTLIVGFDFDG 142 Query: 543 -PHIYCIYPHGSVDKLPYATMGSGSLAAMAVFEAG 644 P +Y P G+ G G +AV + G Sbjct: 143 TPRLYQTDPSGTYHAWKVVQSG-GKNIELAVMKKG 176 >SB_48652| Best HMM Match : RVT_1 (HMM E-Value=0.0009) Length = 938 Score = 35.9 bits (79), Expect = 0.029 Identities = 17/55 (30%), Positives = 30/55 (54%) Frame = +3 Query: 210 TKTGTTIVGIIYADGVILGADTRATENTVVSDKNCQKIHYLASNMYCCGAGTAAD 374 T TGT+++GI + GV++ ADT + ++ +N ++ + N AG AD Sbjct: 872 TTTGTSVLGIKFNGGVLMAADTLGSYGSLARYRNISRLMRVNENTIIGAAGDYAD 926 >SB_50062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 33.1 bits (72), Expect = 0.21 Identities = 17/47 (36%), Positives = 24/47 (51%) Frame = +3 Query: 177 LAQKGFPAPKATKTGTTIVGIIYADGVILGADTRATENTVVSDKNCQ 317 L + G P P + G VG I A G +L + TRA V++ NC+ Sbjct: 84 LKRLGIPPPLLSMGGAEFVGAIRARGGLLFSKTRAARGRQVANVNCE 130 >SB_22053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1670 Score = 30.3 bits (65), Expect = 1.5 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Frame = +3 Query: 372 DTEMTTQSVASQLELQRLHT--GRTVPVETAATLLKRMLFRYQGH 500 D + V S E+ RLHT GR+ PVE LLK+ L + + H Sbjct: 250 DKKDEDSKVMSSQEVSRLHTPQGRSTPVEPHLQLLKQALKQVKPH 294 >SB_28327| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 576 Score = 29.5 bits (63), Expect = 2.6 Identities = 18/42 (42%), Positives = 23/42 (54%) Frame = -1 Query: 600 WLHMVIYLQIHEDKCSKYEDRFCQHLPKPEQPLYGLDSEIAF 475 WL M I +EDK + F +HL K E P+ LD+EI F Sbjct: 53 WLEMKISAAKYEDKIPPFWSDFLKHL-KQEYPVV-LDNEINF 92 >SB_50916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1681 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/24 (54%), Positives = 18/24 (75%) Frame = +3 Query: 351 CGAGTAADTEMTTQSVASQLELQR 422 C GTAA T +T QSVAS ++++R Sbjct: 637 CKRGTAALTNVTKQSVASVVDIER 660 >SB_8505| Best HMM Match : CitD (HMM E-Value=0.91) Length = 909 Score = 27.9 bits (59), Expect = 7.8 Identities = 17/71 (23%), Positives = 29/71 (40%), Gaps = 3/71 (4%) Frame = +3 Query: 315 QKIHYLAS-NMYCCGAGTAADTEMTTQSVASQLELQR--LHTGRTVPVETAATLLKRMLF 485 QK+H + CC + LE+ +H+G +PVE L+ +L Sbjct: 82 QKLHLVYEITALCCAFNPKNLLQKVVDLCVESLEMYNGDVHSGDGLPVEVTLDLVNYLLK 141 Query: 486 RYQGHIGAALV 518 + GH G ++ Sbjct: 142 QESGHDGVTML 152 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,333,594 Number of Sequences: 59808 Number of extensions: 415885 Number of successful extensions: 1095 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1027 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1095 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1705624125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -