BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0303 (663 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 21 7.9 AY375535-1|AAQ82648.1| 147|Apis mellifera doublesex protein. 21 7.9 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 21.4 bits (43), Expect = 7.9 Identities = 13/60 (21%), Positives = 25/60 (41%) Frame = +3 Query: 201 PKATKTGTTIVGIIYADGVILGADTRATENTVVSDKNCQKIHYLASNMYCCGAGTAADTE 380 P+ TK DG++ A + T+N S + ++Y+ + + G A D + Sbjct: 232 PRYTKYTINDESFSLQDGILGMALSHKTQNLYYSAMSSHNLNYVNTKQFTQGKFQANDIQ 291 >AY375535-1|AAQ82648.1| 147|Apis mellifera doublesex protein. Length = 147 Score = 21.4 bits (43), Expect = 7.9 Identities = 7/16 (43%), Positives = 8/16 (50%) Frame = +2 Query: 437 YCTCRNCCHTAETNAI 484 YCTC C TA + Sbjct: 3 YCTCEKCKITANRQQV 18 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 187,950 Number of Sequences: 438 Number of extensions: 4081 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19977660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -