BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0302 (656 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 27 0.12 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 23 3.4 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 22 5.9 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 22 5.9 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 27.5 bits (58), Expect = 0.12 Identities = 19/72 (26%), Positives = 33/72 (45%), Gaps = 1/72 (1%) Frame = -3 Query: 372 Y*SNYVDLSFRSGFFMIEGLLV-AQQPFQFHQDRWASKGSARRGGITTQSNCFANESTTG 196 Y SN + M LL +Q F+ H+D + + R + ++++ AN ST+ Sbjct: 701 YRSNSMGAVMTRNSEMFSSLLSDTEQHFRQHRDSLSPRVENRSAIVHSEASANANSSTSS 760 Query: 195 SESRPAEKLSGL 160 ESR + + L Sbjct: 761 EESREEKATTSL 772 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 22.6 bits (46), Expect = 3.4 Identities = 7/14 (50%), Positives = 12/14 (85%) Frame = -3 Query: 474 LPPVIV*GNSNTYN 433 LPP+++ GN +TY+ Sbjct: 174 LPPLLIMGNEHTYS 187 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.8 bits (44), Expect = 5.9 Identities = 6/12 (50%), Positives = 8/12 (66%) Frame = +2 Query: 290 WKGCWATSNPSI 325 WK CW + P+I Sbjct: 491 WKICWTITTPAI 502 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.8 bits (44), Expect = 5.9 Identities = 6/12 (50%), Positives = 8/12 (66%) Frame = +2 Query: 290 WKGCWATSNPSI 325 WK CW + P+I Sbjct: 544 WKICWTITTPAI 555 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 190,543 Number of Sequences: 438 Number of extensions: 4449 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19734030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -