SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NRPG0302
         (656 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB204559-1|BAD89804.1|  832|Apis mellifera soluble guanylyl cycl...    27   0.12 
AM076717-1|CAJ28210.1|  501|Apis mellifera serotonin receptor pr...    23   3.4  
AY395072-1|AAQ96728.1|  593|Apis mellifera GABA neurotransmitter...    22   5.9  
AY395071-1|AAQ96727.1|  646|Apis mellifera GABA neurotransmitter...    22   5.9  

>AB204559-1|BAD89804.1|  832|Apis mellifera soluble guanylyl cyclase
           beta-3 protein.
          Length = 832

 Score = 27.5 bits (58), Expect = 0.12
 Identities = 19/72 (26%), Positives = 33/72 (45%), Gaps = 1/72 (1%)
 Frame = -3

Query: 372 Y*SNYVDLSFRSGFFMIEGLLV-AQQPFQFHQDRWASKGSARRGGITTQSNCFANESTTG 196
           Y SN +         M   LL   +Q F+ H+D  + +   R   + ++++  AN ST+ 
Sbjct: 701 YRSNSMGAVMTRNSEMFSSLLSDTEQHFRQHRDSLSPRVENRSAIVHSEASANANSSTSS 760

Query: 195 SESRPAEKLSGL 160
            ESR  +  + L
Sbjct: 761 EESREEKATTSL 772


>AM076717-1|CAJ28210.1|  501|Apis mellifera serotonin receptor
           protein.
          Length = 501

 Score = 22.6 bits (46), Expect = 3.4
 Identities = 7/14 (50%), Positives = 12/14 (85%)
 Frame = -3

Query: 474 LPPVIV*GNSNTYN 433
           LPP+++ GN +TY+
Sbjct: 174 LPPLLIMGNEHTYS 187


>AY395072-1|AAQ96728.1|  593|Apis mellifera GABA neurotransmitter
           transporter-1B protein.
          Length = 593

 Score = 21.8 bits (44), Expect = 5.9
 Identities = 6/12 (50%), Positives = 8/12 (66%)
 Frame = +2

Query: 290 WKGCWATSNPSI 325
           WK CW  + P+I
Sbjct: 491 WKICWTITTPAI 502


>AY395071-1|AAQ96727.1|  646|Apis mellifera GABA neurotransmitter
           transporter-1B protein.
          Length = 646

 Score = 21.8 bits (44), Expect = 5.9
 Identities = 6/12 (50%), Positives = 8/12 (66%)
 Frame = +2

Query: 290 WKGCWATSNPSI 325
           WK CW  + P+I
Sbjct: 544 WKICWTITTPAI 555


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 190,543
Number of Sequences: 438
Number of extensions: 4449
Number of successful extensions: 4
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 19734030
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -